Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 804272..804897 | Replicon | chromosome |
Accession | NZ_CP110934 | ||
Organism | Salmonella enterica strain CVCC 519 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | ORG43_RS03800 | Protein ID | WP_000911337.1 |
Coordinates | 804272..804670 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | C0PXM4 |
Locus tag | ORG43_RS03805 | Protein ID | WP_000557545.1 |
Coordinates | 804670..804897 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORG43_RS03785 (800948) | 800948..801532 | - | 585 | WP_001244638.1 | fimbrial protein | - |
ORG43_RS03790 (802251) | 802251..802883 | - | 633 | WP_001540855.1 | YfdX family protein | - |
ORG43_RS03795 (802930) | 802930..803466 | - | 537 | WP_001038500.1 | STM3031 family outer membrane protein | - |
ORG43_RS03800 (804272) | 804272..804670 | - | 399 | WP_000911337.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
ORG43_RS03805 (804670) | 804670..804897 | - | 228 | WP_000557545.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
ORG43_RS03810 (805106) | 805106..805357 | + | 252 | WP_001540858.1 | hypothetical protein | - |
ORG43_RS03815 (805632) | 805632..806439 | + | 808 | Protein_747 | DUF1460 domain-containing protein | - |
ORG43_RS03825 (806724) | 806724..807482 | - | 759 | WP_000244328.1 | amidase activator ActS | - |
ORG43_RS03830 (807747) | 807747..808292 | + | 546 | WP_000133994.1 | isopentenyl-diphosphate Delta-isomerase | - |
ORG43_RS03835 (808368) | 808368..809885 | - | 1518 | WP_000003339.1 | lysine--tRNA ligase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 795875..806439 | 10564 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15037.43 Da Isoelectric Point: 7.7785
>T264511 WP_000911337.1 NZ_CP110934:c804670-804272 [Salmonella enterica]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|