Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 191830..192590 | Replicon | chromosome |
Accession | NZ_CP110934 | ||
Organism | Salmonella enterica strain CVCC 519 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | Q57IH1 |
Locus tag | ORG43_RS00895 | Protein ID | WP_000533909.1 |
Coordinates | 192105..192590 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | M7RHS4 |
Locus tag | ORG43_RS00890 | Protein ID | WP_000965886.1 |
Coordinates | 191830..192117 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORG43_RS00865 (186919) | 186919..187221 | + | 303 | WP_000605590.1 | YsaB family lipoprotein | - |
ORG43_RS00870 (187360) | 187360..188271 | + | 912 | WP_001168551.1 | glycine--tRNA ligase subunit alpha | - |
ORG43_RS00875 (188281) | 188281..190350 | + | 2070 | WP_001291737.1 | glycine--tRNA ligase subunit beta | - |
ORG43_RS00880 (190612) | 190612..191013 | + | 402 | Protein_174 | IS3 family transposase | - |
ORG43_RS00885 (191185) | 191185..191652 | + | 468 | WP_000702450.1 | GNAT family N-acetyltransferase | - |
ORG43_RS00890 (191830) | 191830..192117 | + | 288 | WP_000965886.1 | DUF1778 domain-containing protein | Antitoxin |
ORG43_RS00895 (192105) | 192105..192590 | + | 486 | WP_000533909.1 | GNAT family N-acetyltransferase | Toxin |
ORG43_RS00905 (194276) | 194276..194815 | - | 540 | WP_000047148.1 | copper-binding periplasmic metallochaperone CueP | - |
ORG43_RS00910 (194989) | 194989..195201 | - | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
ORG43_RS00915 (195489) | 195489..195779 | - | 291 | WP_000455790.1 | HTH-type transcriptional regulator | - |
ORG43_RS00920 (196218) | 196218..196928 | + | 711 | WP_001541097.1 | DUF3053 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17703.41 Da Isoelectric Point: 9.8719
>T264508 WP_000533909.1 NZ_CP110934:192105-192590 [Salmonella enterica]
VGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKSSQTQQRTLFLRLP
Q
VGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKSSQTQQRTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 7F36 | |
PDB | 7AK8 | |
PDB | 5FVJ |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V2JDX2 |