Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 950187..951001 | Replicon | chromosome |
| Accession | NZ_CP110931 | ||
| Organism | Salmonella enterica strain XM3104 | ||
Toxin (Protein)
| Gene name | TacT3 | Uniprot ID | Q57KM2 |
| Locus tag | ORG44_RS04550 | Protein ID | WP_000971655.1 |
| Coordinates | 950187..950714 (-) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | TacA3 | Uniprot ID | M7S6I2 |
| Locus tag | ORG44_RS04555 | Protein ID | WP_000855694.1 |
| Coordinates | 950711..951001 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ORG44_RS04520 (946486) | 946486..946884 | + | 399 | Protein_885 | cytoplasmic protein | - |
| ORG44_RS04525 (947075) | 947075..947314 | + | 240 | Protein_886 | hypothetical protein | - |
| ORG44_RS04530 (947471) | 947471..948139 | + | 669 | WP_001540791.1 | hypothetical protein | - |
| ORG44_RS04535 (948166) | 948166..948660 | + | 495 | WP_001540790.1 | hypothetical protein | - |
| ORG44_RS04540 (948905) | 948905..949561 | - | 657 | WP_000420452.1 | protein-serine/threonine phosphatase | - |
| ORG44_RS04545 (949899) | 949899..950114 | + | 216 | Protein_890 | IS5/IS1182 family transposase | - |
| ORG44_RS04550 (950187) | 950187..950714 | - | 528 | WP_000971655.1 | GNAT family N-acetyltransferase | Toxin |
| ORG44_RS04555 (950711) | 950711..951001 | - | 291 | WP_000855694.1 | DUF1778 domain-containing protein | Antitoxin |
| ORG44_RS04560 (951271) | 951271..951456 | - | 186 | Protein_893 | IS3 family transposase | - |
| ORG44_RS04565 (951874) | 951874..952317 | - | 444 | WP_000715102.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
| ORG44_RS04570 (952773) | 952773..953423 | + | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
| ORG44_RS04575 (953420) | 953420..955108 | + | 1689 | WP_001540787.1 | type III secretion system outer membrane ring protein InvG | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | invH / invF / invG / invE / invA / invB | 949974..958736 | 8762 | |
| - | flank | IS/Tn | - | - | 949974..950114 | 140 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19069.91 Da Isoelectric Point: 9.6420
>T264496 WP_000971655.1 NZ_CP110931:c950714-950187 [Salmonella enterica]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6G96 | |
| PDB | 7AK9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3V8SJE7 |