Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 2252490..2253166 | Replicon | chromosome |
| Accession | NZ_CP110921 | ||
| Organism | Methylococcus sp. 16-5 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | OOT43_RS10565 | Protein ID | WP_266020540.1 |
| Coordinates | 2252490..2252897 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | OOT43_RS10570 | Protein ID | WP_266020541.1 |
| Coordinates | 2252894..2253166 (-) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OOT43_RS10540 (OOT43_10540) | 2247708..2248682 | - | 975 | WP_266020537.1 | tRNA 5-methoxyuridine(34)/uridine 5-oxyacetic acid(34) synthase CmoB | - |
| OOT43_RS10545 (OOT43_10545) | 2248778..2249692 | + | 915 | WP_266020538.1 | oxygen-dependent coproporphyrinogen oxidase | - |
| OOT43_RS10550 (OOT43_10550) | 2249687..2250337 | - | 651 | WP_266020539.1 | ABC transporter substrate-binding protein | - |
| OOT43_RS10555 (OOT43_10555) | 2250452..2251456 | + | 1005 | WP_266024888.1 | porphobilinogen synthase | - |
| OOT43_RS10560 (OOT43_10560) | 2251453..2252292 | + | 840 | WP_266024889.1 | shikimate dehydrogenase | - |
| OOT43_RS10565 (OOT43_10565) | 2252490..2252897 | - | 408 | WP_266020540.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OOT43_RS10570 (OOT43_10570) | 2252894..2253166 | - | 273 | WP_266020541.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| OOT43_RS10575 (OOT43_10575) | 2253315..2253659 | - | 345 | WP_266020542.1 | phenylpyruvate tautomerase MIF-related protein | - |
| OOT43_RS10580 (OOT43_10580) | 2253862..2254221 | + | 360 | WP_266020543.1 | MbcA/ParS/Xre antitoxin family protein | - |
| OOT43_RS10585 (OOT43_10585) | 2254287..2254970 | + | 684 | WP_266020544.1 | RES family NAD+ phosphorylase | - |
| OOT43_RS10590 (OOT43_10590) | 2255017..2255556 | - | 540 | WP_266020545.1 | transposase | - |
| OOT43_RS10595 (OOT43_10595) | 2256092..2256871 | - | 780 | WP_266020546.1 | hypothetical protein | - |
| OOT43_RS10600 (OOT43_10600) | 2257071..2257613 | - | 543 | WP_266024891.1 | gamma carbonic anhydrase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 14985.74 Da Isoelectric Point: 9.4601
>T264487 WP_266020540.1 NZ_CP110921:c2252897-2252490 [Methylococcus sp. 16-5]
MSVLHMLDTDIASYVIKGRSPAVEAKLMAIVPSMVCISAVTRAELMYGLKRLLAGHRLHLAVRRFLKIVRVLSWDAEAAD
YYADIRHQLVSTGQPIGEMDMMIAAHSLSAGAMLVTNNVRHYSRIEAPLLLVNWA
MSVLHMLDTDIASYVIKGRSPAVEAKLMAIVPSMVCISAVTRAELMYGLKRLLAGHRLHLAVRRFLKIVRVLSWDAEAAD
YYADIRHQLVSTGQPIGEMDMMIAAHSLSAGAMLVTNNVRHYSRIEAPLLLVNWA
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|