Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 2148949..2149471 | Replicon | chromosome |
| Accession | NZ_CP110921 | ||
| Organism | Methylococcus sp. 16-5 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | OOT43_RS10045 | Protein ID | WP_266024792.1 |
| Coordinates | 2148949..2149236 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | OOT43_RS10050 | Protein ID | WP_266024793.1 |
| Coordinates | 2149226..2149471 (-) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OOT43_RS10020 (OOT43_10020) | 2144070..2145644 | - | 1575 | WP_266024784.1 | class I SAM-dependent DNA methyltransferase | - |
| OOT43_RS10025 (OOT43_10025) | 2145800..2146642 | - | 843 | WP_266024785.1 | DUF3037 domain-containing protein | - |
| OOT43_RS10030 (OOT43_10030) | 2146639..2147373 | - | 735 | WP_266024786.1 | hypothetical protein | - |
| OOT43_RS10035 (OOT43_10035) | 2147370..2148797 | - | 1428 | WP_266024788.1 | restriction endonuclease subunit S | - |
| OOT43_RS10040 (OOT43_10040) | 2148794..2148952 | - | 159 | WP_266024790.1 | type I restriction-modification enzyme R subunit C-terminal domain-containing protein | - |
| OOT43_RS10045 (OOT43_10045) | 2148949..2149236 | - | 288 | WP_266024792.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OOT43_RS10050 (OOT43_10050) | 2149226..2149471 | - | 246 | WP_266024793.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
| OOT43_RS10055 (OOT43_10055) | 2149527..2152385 | - | 2859 | WP_266024795.1 | type I restriction-modification enzyme R subunit C-terminal domain-containing protein | - |
| OOT43_RS10060 (OOT43_10060) | 2152441..2152929 | - | 489 | WP_266024797.1 | protein disulfide oxidoreductase | - |
| OOT43_RS10065 (OOT43_10065) | 2152929..2153663 | - | 735 | WP_266024800.1 | SprT family zinc-dependent metalloprotease | - |
| OOT43_RS10070 (OOT43_10070) | 2153673..2154173 | - | 501 | WP_266024802.1 | GreA/GreB family elongation factor | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11140.93 Da Isoelectric Point: 10.4470
>T264486 WP_266024792.1 NZ_CP110921:c2149236-2148949 [Methylococcus sp. 16-5]
MTYSLEFRDSAWKEWQNLDRPLHEQFKAKLLERLANPRVESARLSGLPDCYKIKLRAAGYRLVYQVFDERVVVVVVAVGK
REDSAVYRKARGRVK
MTYSLEFRDSAWKEWQNLDRPLHEQFKAKLLERLANPRVESARLSGLPDCYKIKLRAAGYRLVYQVFDERVVVVVVAVGK
REDSAVYRKARGRVK
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|