Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-Phd |
| Location | 1772413..1773080 | Replicon | chromosome |
| Accession | NZ_CP110921 | ||
| Organism | Methylococcus sp. 16-5 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | OOT43_RS08225 | Protein ID | WP_266024377.1 |
| Coordinates | 1772413..1772838 (-) | Length | 142 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | OOT43_RS08230 | Protein ID | WP_266024378.1 |
| Coordinates | 1772835..1773080 (-) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OOT43_RS08200 (OOT43_08200) | 1767439..1767906 | - | 468 | WP_266024371.1 | cysteine rich repeat-containing protein | - |
| OOT43_RS08205 (OOT43_08205) | 1768205..1768888 | + | 684 | WP_266024372.1 | protein-methionine-sulfoxide reductase heme-binding subunit MsrQ | - |
| OOT43_RS08210 (OOT43_08210) | 1769170..1769799 | - | 630 | WP_266024374.1 | hypothetical protein | - |
| OOT43_RS08215 (OOT43_08215) | 1770099..1770425 | - | 327 | WP_266024375.1 | hypothetical protein | - |
| OOT43_RS08220 (OOT43_08220) | 1771709..1771939 | + | 231 | WP_266024376.1 | DUF1353 domain-containing protein | - |
| OOT43_RS08225 (OOT43_08225) | 1772413..1772838 | - | 426 | WP_266024377.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OOT43_RS08230 (OOT43_08230) | 1772835..1773080 | - | 246 | WP_266024378.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| OOT43_RS08235 (OOT43_08235) | 1773303..1773656 | + | 354 | WP_266024379.1 | DUF1778 domain-containing protein | - |
| OOT43_RS08240 (OOT43_08240) | 1773954..1774136 | + | 183 | WP_266024858.1 | hypothetical protein | - |
| OOT43_RS08245 (OOT43_08245) | 1774415..1776556 | + | 2142 | WP_266024380.1 | hypothetical protein | - |
| OOT43_RS08250 (OOT43_08250) | 1777220..1777612 | + | 393 | WP_266024381.1 | DUF4440 domain-containing protein | - |
| OOT43_RS08255 (OOT43_08255) | 1777694..1777927 | - | 234 | WP_266024382.1 | addiction module protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 15558.01 Da Isoelectric Point: 4.9058
>T264485 WP_266024377.1 NZ_CP110921:c1772838-1772413 [Methylococcus sp. 16-5]
VSYLLDTCVLSELRKPAPDPNVTAWVEAVDESRLFISVIVLGEIQKGIAKLEDARRSQVLQLWLEQDLQGRFEGRILPVN
AAVALEWGVLQGSAAKSGLSLPVIDSLIGATAVCHNLTLVTRNTADFERMPVRLLNPWVRE
VSYLLDTCVLSELRKPAPDPNVTAWVEAVDESRLFISVIVLGEIQKGIAKLEDARRSQVLQLWLEQDLQGRFEGRILPVN
AAVALEWGVLQGSAAKSGLSLPVIDSLIGATAVCHNLTLVTRNTADFERMPVRLLNPWVRE
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|