Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yoeB-relE/YoeB-YefM
Location 1332015..1332517 Replicon chromosome
Accession NZ_CP110921
Organism Methylococcus sp. 16-5

Toxin (Protein)


Gene name yoeB Uniprot ID -
Locus tag OOT43_RS06020 Protein ID WP_266023917.1
Coordinates 1332263..1332517 (+) Length 85 a.a.

Antitoxin (Protein)


Gene name relE Uniprot ID -
Locus tag OOT43_RS06015 Protein ID WP_266023915.1
Coordinates 1332015..1332266 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OOT43_RS05980 (OOT43_05980) 1327474..1327593 + 120 Protein_1186 IS5/IS1182 family transposase -
OOT43_RS05985 (OOT43_05985) 1328019..1328282 - 264 WP_266023905.1 Txe/YoeB family addiction module toxin -
OOT43_RS05990 (OOT43_05990) 1328279..1328521 - 243 WP_266023906.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
OOT43_RS05995 (OOT43_05995) 1328588..1328758 - 171 WP_266023908.1 type II toxin-antitoxin system HicB family antitoxin -
OOT43_RS06000 (OOT43_06000) 1329085..1330026 + 942 WP_266023910.1 pentapeptide repeat-containing protein -
OOT43_RS06005 (OOT43_06005) 1330305..1330844 - 540 WP_266023911.1 class I SAM-dependent methyltransferase -
OOT43_RS06010 (OOT43_06010) 1331182..1331901 + 720 WP_266023914.1 alpha/beta hydrolase family protein -
OOT43_RS06015 (OOT43_06015) 1332015..1332266 + 252 WP_266023915.1 type II toxin-antitoxin system prevent-host-death family antitoxin Antitoxin
OOT43_RS06020 (OOT43_06020) 1332263..1332517 + 255 WP_266023917.1 Txe/YoeB family addiction module toxin Toxin
OOT43_RS06025 (OOT43_06025) 1333422..1333988 + 567 WP_266023919.1 CHRD domain-containing protein -
OOT43_RS06030 (OOT43_06030) 1334164..1335288 + 1125 WP_266023920.1 hypothetical protein -
OOT43_RS06035 (OOT43_06035) 1335382..1335522 - 141 WP_266023921.1 hypothetical protein -
OOT43_RS06040 (OOT43_06040) 1335587..1335847 - 261 WP_266023923.1 DUF2442 domain-containing protein -
OOT43_RS06045 (OOT43_06045) 1335911..1336564 - 654 WP_266023925.1 nuclease-related domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 1327839..1350844 23005
- flank IS/Tn - - 1327109..1327372 263


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(2-84)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-73)


Sequences

Toxin        


Download         Length: 85 a.a.        Molecular weight: 10261.78 Da        Isoelectric Point: 7.3986

>T264483 WP_266023917.1 NZ_CP110921:1332263-1332517 [Methylococcus sp. 16-5]
VKLIFAEQAWEDYVYWQQQDKRMVKRINELIEHTMRDPFTGIGKPEPLKHALSGFWSRRITDEHRMVYKPEEDALLIAQL
RYHY

Download         Length: 255 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9175.52 Da        Isoelectric Point: 5.8290

>AT264483 WP_266023915.1 NZ_CP110921:1332015-1332266 [Methylococcus sp. 16-5]
MDAITYTAARANLAKTMDRVCNDHEPLIITRNGEQSVVMLSLEDFKSLEETAYLLRSPANAKRLLAAIEALQAGKGQERK
LAE

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References