Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 82486..82997 Replicon plasmid pCF1807-3
Accession NZ_CP110896
Organism Citrobacter freundii strain CF1807

Toxin (Protein)


Gene name relE Uniprot ID W0NIW1
Locus tag OQW59_RS28655 Protein ID WP_020956903.1
Coordinates 82722..82997 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag OQW59_RS28650 Protein ID WP_020956904.1
Coordinates 82486..82710 (+) Length 75 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OQW59_RS28610 (OQW59_28610) 78910..79269 - 360 WP_020956911.1 hypothetical protein -
OQW59_RS28615 (OQW59_28615) 79377..79901 + 525 WP_020956910.1 DnaJ domain-containing protein -
OQW59_RS28620 (OQW59_28620) 79992..80534 + 543 WP_020956909.1 hypothetical protein -
OQW59_RS28625 (OQW59_28625) 80531..80776 + 246 WP_020956908.1 hypothetical protein -
OQW59_RS28630 (OQW59_28630) 80773..80994 + 222 WP_020956907.1 helix-turn-helix domain-containing protein -
OQW59_RS28635 (OQW59_28635) 80999..81280 + 282 WP_088912116.1 hypothetical protein -
OQW59_RS28640 (OQW59_28640) 81664..81876 + 213 WP_020956906.1 hypothetical protein -
OQW59_RS28645 (OQW59_28645) 81934..82182 + 249 WP_020956905.1 hypothetical protein -
OQW59_RS28650 (OQW59_28650) 82486..82710 + 225 WP_020956904.1 DUF6290 family protein Antitoxin
OQW59_RS28655 (OQW59_28655) 82722..82997 + 276 WP_020956903.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
OQW59_RS28660 (OQW59_28660) 83019..83285 + 267 WP_020956902.1 hypothetical protein -
OQW59_RS28665 (OQW59_28665) 83727..84281 + 555 WP_020956901.1 DNA distortion polypeptide 1 -
OQW59_RS28670 (OQW59_28670) 84283..85473 + 1191 WP_041937886.1 MobP1 family relaxase -
OQW59_RS28675 (OQW59_28675) 85503..85835 - 333 WP_227551116.1 helix-turn-helix transcriptional regulator -
OQW59_RS28680 (OQW59_28680) 86049..86687 + 639 WP_265869294.1 lytic transglycosylase domain-containing protein -
OQW59_RS28685 (OQW59_28685) 86674..86961 + 288 WP_020956899.1 TrbC/VirB2 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaKPC-2 - 1..106844 106844


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(7-88)

Antitoxin

Protein of unknown function DUF6290

(6-72)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10922.82 Da        Isoelectric Point: 10.6500

>T264482 WP_020956903.1 NZ_CP110896:82722-82997 [Citrobacter freundii]
MTRYRTEYTKRFVKEFKKIDTVHQRVIQKYIEAHINNALNPRLTGKILKGDKAEFIRWRIGDYRLIATIEDDKLLVIALS
VGHRKDVYKKF

Download         Length: 276 bp

Antitoxin


Download         Length: 75 a.a.        Molecular weight: 8535.52 Da        Isoelectric Point: 4.3313

>AT264482 WP_020956904.1 NZ_CP110896:82486-82710 [Citrobacter freundii]
MNKNMTKAIRLNDEDFNLFESYANAKGITFSELCKSAVREKIEDELDLQCANESYADYLSDKTTISHDELFKSM

Download         Length: 225 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A384ZT31

Antitoxin

Source ID Structure

References