Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 4971721..4972337 | Replicon | chromosome |
Accession | NZ_CP110894 | ||
Organism | Citrobacter freundii strain CF1807 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A0J1MQ96 |
Locus tag | OQW59_RS27260 | Protein ID | WP_003028682.1 |
Coordinates | 4971721..4972095 (-) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A6B5NTK4 |
Locus tag | OQW59_RS27265 | Protein ID | WP_043018956.1 |
Coordinates | 4972095..4972337 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OQW59_RS27245 (4969224) | 4969224..4970126 | + | 903 | WP_003847898.1 | formate dehydrogenase O subunit beta | - |
OQW59_RS27250 (4970123) | 4970123..4970758 | + | 636 | WP_003028686.1 | formate dehydrogenase cytochrome b556 subunit | - |
OQW59_RS27255 (4970755) | 4970755..4971684 | + | 930 | WP_003028685.1 | formate dehydrogenase accessory protein FdhE | - |
OQW59_RS27260 (4971721) | 4971721..4972095 | - | 375 | WP_003028682.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OQW59_RS27265 (4972095) | 4972095..4972337 | - | 243 | WP_043018956.1 | CopG family transcriptional regulator | Antitoxin |
OQW59_RS27270 (4972543) | 4972543..4973451 | + | 909 | WP_003847901.1 | alpha/beta hydrolase | - |
OQW59_RS27275 (4973602) | 4973602..4974543 | - | 942 | WP_003825286.1 | fatty acid biosynthesis protein FabY | - |
OQW59_RS27280 (4974588) | 4974588..4975025 | - | 438 | WP_003028671.1 | D-aminoacyl-tRNA deacylase | - |
OQW59_RS27285 (4975022) | 4975022..4975894 | - | 873 | WP_060854619.1 | virulence factor BrkB family protein | - |
OQW59_RS27290 (4975888) | 4975888..4976487 | - | 600 | WP_016151258.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13674.89 Da Isoelectric Point: 9.5622
>T264479 WP_003028682.1 NZ_CP110894:c4972095-4971721 [Citrobacter freundii]
MVKGSALFDTNILIDLFSGRNEAKLAIETWPPQNAISLITWMEVMVGAKKYHQEARTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTKDFAGLSGVVTPYTL
MVKGSALFDTNILIDLFSGRNEAKLAIETWPPQNAISLITWMEVMVGAKKYHQEARTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTKDFAGLSGVVTPYTL
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J1MQ96 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6B5NTK4 |