Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
Location | 4787282..4787948 | Replicon | chromosome |
Accession | NZ_CP110894 | ||
Organism | Citrobacter freundii strain CF1807 |
Toxin (Protein)
Gene name | tad | Uniprot ID | - |
Locus tag | OQW59_RS26355 | Protein ID | WP_134214823.1 |
Coordinates | 4787589..4787948 (-) | Length | 120 a.a. |
Antitoxin (Protein)
Gene name | ata | Uniprot ID | - |
Locus tag | OQW59_RS26350 | Protein ID | WP_134214821.1 |
Coordinates | 4787282..4787599 (-) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OQW59_RS26310 (4782570) | 4782570..4783394 | + | 825 | WP_048216971.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
OQW59_RS26315 (4783462) | 4783462..4784685 | + | 1224 | WP_003031639.1 | L-sorbose 1-phosphate reductase | - |
OQW59_RS26320 (4784687) | 4784687..4785499 | + | 813 | WP_148374214.1 | shikimate 5-dehydrogenase | - |
OQW59_RS26325 (4785533) | 4785533..4785850 | - | 318 | WP_054527950.1 | CcdB family protein | - |
OQW59_RS26330 (4785850) | 4785850..4786143 | - | 294 | WP_003844689.1 | type II toxin-antitoxin system CcdA family antitoxin | - |
OQW59_RS26335 (4786240) | 4786240..4786605 | - | 366 | WP_134214819.1 | hypothetical protein | - |
OQW59_RS26340 (4786737) | 4786737..4786910 | + | 174 | WP_032938222.1 | hypothetical protein | - |
OQW59_RS26345 (4786981) | 4786981..4787142 | + | 162 | WP_003841416.1 | phage protein | - |
OQW59_RS26350 (4787282) | 4787282..4787599 | - | 318 | WP_134214821.1 | helix-turn-helix transcriptional regulator | Antitoxin |
OQW59_RS26355 (4787589) | 4787589..4787948 | - | 360 | WP_134214823.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OQW59_RS26360 (4788162) | 4788162..4788851 | + | 690 | WP_003841421.1 | dipeptidase PepE | - |
OQW59_RS26365 (4788998) | 4788998..4790629 | - | 1632 | WP_003031618.1 | Na/Pi cotransporter family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 13456.53 Da Isoelectric Point: 10.2555
>T264478 WP_134214823.1 NZ_CP110894:c4787948-4787589 [Citrobacter freundii]
MTKPLYWVGQARKDLLAMPEHVRDTFGFAFWLAQQGKQHSQTKPLKGFGGAGVLEVVEDYHGSAWRAVYTIQLKNAVYVL
HVFQKKSVSGKATPKPEIDLIYQRLKAAQRHAQESGYVI
MTKPLYWVGQARKDLLAMPEHVRDTFGFAFWLAQQGKQHSQTKPLKGFGGAGVLEVVEDYHGSAWRAVYTIQLKNAVYVL
HVFQKKSVSGKATPKPEIDLIYQRLKAAQRHAQESGYVI
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|