Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 4220446..4221100 | Replicon | chromosome |
| Accession | NZ_CP110894 | ||
| Organism | Citrobacter freundii strain CF1807 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A0J1NHY7 |
| Locus tag | OQW59_RS23610 | Protein ID | WP_003026936.1 |
| Coordinates | 4220446..4220853 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A6H3AT26 |
| Locus tag | OQW59_RS23615 | Protein ID | WP_003026938.1 |
| Coordinates | 4220834..4221100 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OQW59_RS23590 (4216389) | 4216389..4218122 | - | 1734 | WP_016150943.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| OQW59_RS23595 (4218128) | 4218128..4218841 | - | 714 | WP_003825520.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| OQW59_RS23600 (4218870) | 4218870..4219766 | - | 897 | WP_003026928.1 | site-specific tyrosine recombinase XerD | - |
| OQW59_RS23605 (4219880) | 4219880..4220401 | + | 522 | WP_003026933.1 | flavodoxin FldB | - |
| OQW59_RS23610 (4220446) | 4220446..4220853 | - | 408 | WP_003026936.1 | protein YgfX | Toxin |
| OQW59_RS23615 (4220834) | 4220834..4221100 | - | 267 | WP_003026938.1 | FAD assembly factor SdhE | Antitoxin |
| OQW59_RS23620 (4221357) | 4221357..4222337 | + | 981 | WP_003026944.1 | tRNA-modifying protein YgfZ | - |
| OQW59_RS23625 (4222431) | 4222431..4223090 | - | 660 | WP_003838267.1 | hemolysin III family protein | - |
| OQW59_RS23630 (4223253) | 4223253..4223564 | - | 312 | WP_003026949.1 | N(4)-acetylcytidine aminohydrolase | - |
| OQW59_RS23635 (4223617) | 4223617..4224345 | + | 729 | WP_003838265.1 | MurR/RpiR family transcriptional regulator | - |
| OQW59_RS23640 (4224466) | 4224466..4225899 | + | 1434 | WP_148374026.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15953.89 Da Isoelectric Point: 11.4054
>T264477 WP_003026936.1 NZ_CP110894:c4220853-4220446 [Citrobacter freundii]
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWSIVSAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLMLQKAKQK
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWSIVSAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLMLQKAKQK
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J1NHY7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6H3AT26 |