Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
| Location | 4143481..4144142 | Replicon | chromosome |
| Accession | NZ_CP110894 | ||
| Organism | Citrobacter freundii strain CF1807 | ||
Toxin (Protein)
| Gene name | ypjF | Uniprot ID | - |
| Locus tag | OQW59_RS23215 | Protein ID | WP_048997879.1 |
| Coordinates | 4143481..4143804 (-) | Length | 108 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | A0A241Q747 |
| Locus tag | OQW59_RS23220 | Protein ID | WP_048997880.1 |
| Coordinates | 4143825..4144142 (-) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OQW59_RS23205 (4139424) | 4139424..4141886 | - | 2463 | WP_265867874.1 | poly-beta-1,6 N-acetyl-D-glucosamine export porin PgaA | - |
| OQW59_RS23210 (4142703) | 4142703..4143239 | + | 537 | WP_086529874.1 | GNAT family N-acetyltransferase | - |
| OQW59_RS23215 (4143481) | 4143481..4143804 | - | 324 | WP_048997879.1 | TA system toxin CbtA family protein | Toxin |
| OQW59_RS23220 (4143825) | 4143825..4144142 | - | 318 | WP_048997880.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| OQW59_RS23225 (4144161) | 4144161..4144382 | - | 222 | WP_048997881.1 | DUF987 domain-containing protein | - |
| OQW59_RS23230 (4144391) | 4144391..4144867 | - | 477 | WP_049016517.1 | RadC family protein | - |
| OQW59_RS23235 (4144883) | 4144883..4145341 | - | 459 | WP_049016518.1 | antirestriction protein | - |
| OQW59_RS23240 (4145444) | 4145444..4145683 | - | 240 | WP_048998188.1 | DUF905 domain-containing protein | - |
| OQW59_RS23245 (4145761) | 4145761..4146171 | - | 411 | WP_048998189.1 | hypothetical protein | - |
| OQW59_RS23250 (4146261) | 4146261..4146434 | - | 174 | WP_247752792.1 | hypothetical protein | - |
| OQW59_RS23255 (4146545) | 4146545..4146826 | - | 282 | WP_247752793.1 | hypothetical protein | - |
| OQW59_RS23260 (4146878) | 4146878..4147414 | - | 537 | WP_048998191.1 | DUF4339 domain-containing protein | - |
| OQW59_RS23265 (4147440) | 4147440..4148150 | - | 711 | WP_213168078.1 | DeoR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 12455.32 Da Isoelectric Point: 6.4624
>T264476 WP_048997879.1 NZ_CP110894:c4143804-4143481 [Citrobacter freundii]
MKSQPATTQRAAKPCLSPVDVWQMLLTRLLEQHYGLTLNDTPFSEERVIQEHIDAGITLADAINFLVEKYELVRIDRRGF
SWQEQTPYLTIIDIMRARRDLGLLNRN
MKSQPATTQRAAKPCLSPVDVWQMLLTRLLEQHYGLTLNDTPFSEERVIQEHIDAGITLADAINFLVEKYELVRIDRRGF
SWQEQTPYLTIIDIMRARRDLGLLNRN
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|