Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
Location | 1926286..1926876 | Replicon | chromosome |
Accession | NZ_CP110894 | ||
Organism | Citrobacter freundii strain CF1807 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | A0A0J1NBD3 |
Locus tag | OQW59_RS12100 | Protein ID | WP_003836692.1 |
Coordinates | 1926544..1926876 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | A0A0J1NBD4 |
Locus tag | OQW59_RS12095 | Protein ID | WP_003836694.1 |
Coordinates | 1926286..1926543 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OQW59_RS12090 (1921773) | 1921773..1925672 | - | 3900 | WP_265868936.1 | hypothetical protein | - |
OQW59_RS12095 (1926286) | 1926286..1926543 | + | 258 | WP_003836694.1 | hypothetical protein | Antitoxin |
OQW59_RS12100 (1926544) | 1926544..1926876 | + | 333 | WP_003836692.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
OQW59_RS12110 (1927351) | 1927351..1928268 | + | 918 | WP_003030855.1 | nitrogen assimilation transcriptional regulator NAC | - |
OQW59_RS12115 (1928370) | 1928370..1929320 | + | 951 | WP_003846751.1 | HTH-type transcriptional regulator Cbl | - |
OQW59_RS12125 (1929636) | 1929636..1931123 | - | 1488 | WP_003846749.1 | EmmdR/YeeO family multidrug/toxin efflux MATE transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1910946..1938311 | 27365 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11703.48 Da Isoelectric Point: 8.5572
>T264470 WP_003836692.1 NZ_CP110894:1926544-1926876 [Citrobacter freundii]
MDRGEIWLVSLDPTAGHEQSGKRPVLIVSPASFNKFTRLPVVVPVTSGGNFARAAGFTVSLDGAGTKTTGVIRCDQPRTI
DMGARNGKCLERIPEAVVNEVLARLEAILS
MDRGEIWLVSLDPTAGHEQSGKRPVLIVSPASFNKFTRLPVVVPVTSGGNFARAAGFTVSLDGAGTKTTGVIRCDQPRTI
DMGARNGKCLERIPEAVVNEVLARLEAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J1NBD3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J1NBD4 |