Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1231923..1232543 | Replicon | chromosome |
Accession | NZ_CP110894 | ||
Organism | Citrobacter freundii strain CF1807 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | OQW59_RS08825 | Protein ID | WP_002892050.1 |
Coordinates | 1231923..1232141 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | R8WZW8 |
Locus tag | OQW59_RS08830 | Protein ID | WP_003021733.1 |
Coordinates | 1232169..1232543 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OQW59_RS08790 (1227156) | 1227156..1227785 | + | 630 | WP_016149709.1 | membrane protein | - |
OQW59_RS08795 (1227850) | 1227850..1228203 | + | 354 | WP_003831033.1 | DUF1428 family protein | - |
OQW59_RS08800 (1228255) | 1228255..1229808 | - | 1554 | WP_265867542.1 | EAL domain-containing protein | - |
OQW59_RS08805 (1229997) | 1229997..1230257 | + | 261 | WP_003021719.1 | type B 50S ribosomal protein L31 | - |
OQW59_RS08810 (1230259) | 1230259..1230399 | + | 141 | WP_005125190.1 | type B 50S ribosomal protein L36 | - |
OQW59_RS08815 (1230478) | 1230478..1230948 | - | 471 | WP_003021724.1 | YlaC family protein | - |
OQW59_RS08820 (1231065) | 1231065..1231616 | - | 552 | WP_032936967.1 | maltose O-acetyltransferase | - |
OQW59_RS08825 (1231923) | 1231923..1232141 | - | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
OQW59_RS08830 (1232169) | 1232169..1232543 | - | 375 | WP_003021733.1 | Hha toxicity modulator TomB | Antitoxin |
OQW59_RS08835 (1233032) | 1233032..1236181 | - | 3150 | WP_265970545.1 | efflux RND transporter permease AcrB | - |
OQW59_RS08840 (1236204) | 1236204..1237397 | - | 1194 | WP_003835922.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T264469 WP_002892050.1 NZ_CP110894:c1232141-1231923 [Citrobacter freundii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14427.23 Da Isoelectric Point: 5.5653
>AT264469 WP_003021733.1 NZ_CP110894:c1232543-1232169 [Citrobacter freundii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | R8WZW8 |