Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 578151..578667 | Replicon | chromosome |
Accession | NZ_CP110894 | ||
Organism | Citrobacter freundii strain CF1807 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A0D7LMW6 |
Locus tag | OQW59_RS05830 | Protein ID | WP_003839578.1 |
Coordinates | 578383..578667 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0J1MV10 |
Locus tag | OQW59_RS05825 | Protein ID | WP_003839576.1 |
Coordinates | 578151..578393 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OQW59_RS05805 (573166) | 573166..574299 | + | 1134 | WP_016149471.1 | amidohydrolase/deacetylase family metallohydrolase | - |
OQW59_RS05810 (574283) | 574283..575401 | + | 1119 | WP_003025770.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
OQW59_RS05815 (575398) | 575398..576138 | + | 741 | WP_003025772.1 | KDGP aldolase family protein | - |
OQW59_RS05820 (576160) | 576160..578073 | + | 1914 | WP_213169412.1 | BglG family transcription antiterminator | - |
OQW59_RS05825 (578151) | 578151..578393 | + | 243 | WP_003839576.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
OQW59_RS05830 (578383) | 578383..578667 | + | 285 | WP_003839578.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OQW59_RS05835 (578671) | 578671..579135 | - | 465 | WP_032937736.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
OQW59_RS05840 (579242) | 579242..581380 | - | 2139 | WP_003844922.1 | anaerobic ribonucleoside-triphosphate reductase | - |
OQW59_RS05845 (581758) | 581758..582342 | - | 585 | WP_213169125.1 | fructose PTS transporter subunit IIA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10866.68 Da Isoelectric Point: 10.0482
>T264468 WP_003839578.1 NZ_CP110894:578383-578667 [Citrobacter freundii]
MTYELEFDPRALKEWHKLGDTVKAQFKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVTVFVVAVGK
REHSAVYLDANKRL
MTYELEFDPRALKEWHKLGDTVKAQFKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVTVFVVAVGK
REHSAVYLDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0D7LMW6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J1MV10 |