Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 284650..285236 | Replicon | chromosome |
| Accession | NZ_CP110894 | ||
| Organism | Citrobacter freundii strain CF1807 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | - |
| Locus tag | OQW59_RS04290 | Protein ID | WP_213168140.1 |
| Coordinates | 284868..285236 (+) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | A0A0J1N092 |
| Locus tag | OQW59_RS04285 | Protein ID | WP_032937236.1 |
| Coordinates | 284650..284871 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OQW59_RS04260 (280449) | 280449..281375 | + | 927 | WP_003023435.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| OQW59_RS04265 (281372) | 281372..282649 | + | 1278 | WP_032950432.1 | branched chain amino acid ABC transporter permease LivM | - |
| OQW59_RS04270 (282646) | 282646..283413 | + | 768 | WP_003023438.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| OQW59_RS04275 (283431) | 283431..284144 | + | 714 | WP_003827581.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
| OQW59_RS04280 (284247) | 284247..284528 | + | 282 | WP_003023442.1 | hypothetical protein | - |
| OQW59_RS04285 (284650) | 284650..284871 | + | 222 | WP_032937236.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| OQW59_RS04290 (284868) | 284868..285236 | + | 369 | WP_213168140.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| OQW59_RS04295 (285480) | 285480..286796 | + | 1317 | WP_213168142.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
| OQW59_RS04300 (286897) | 286897..287784 | + | 888 | WP_003837841.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
| OQW59_RS04305 (287781) | 287781..288626 | + | 846 | WP_003837843.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
| OQW59_RS04310 (288629) | 288629..289699 | + | 1071 | WP_003837845.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 281372..290439 | 9067 | |
| - | inside | Prophage | - | - | 274073..290439 | 16366 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13645.97 Da Isoelectric Point: 6.9891
>T264466 WP_213168140.1 NZ_CP110894:284868-285236 [Citrobacter freundii]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEALMYRVLNQIEYEGVTDVWLLVAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIVLSANPDFVAMTVEAAAGQLTLEQIAHRLRH
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEALMYRVLNQIEYEGVTDVWLLVAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIVLSANPDFVAMTVEAAAGQLTLEQIAHRLRH
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|