Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 284650..285236 Replicon chromosome
Accession NZ_CP110894
Organism Citrobacter freundii strain CF1807

Toxin (Protein)


Gene name doc Uniprot ID -
Locus tag OQW59_RS04290 Protein ID WP_213168140.1
Coordinates 284868..285236 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A0J1N092
Locus tag OQW59_RS04285 Protein ID WP_032937236.1
Coordinates 284650..284871 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OQW59_RS04260 (280449) 280449..281375 + 927 WP_003023435.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
OQW59_RS04265 (281372) 281372..282649 + 1278 WP_032950432.1 branched chain amino acid ABC transporter permease LivM -
OQW59_RS04270 (282646) 282646..283413 + 768 WP_003023438.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
OQW59_RS04275 (283431) 283431..284144 + 714 WP_003827581.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
OQW59_RS04280 (284247) 284247..284528 + 282 WP_003023442.1 hypothetical protein -
OQW59_RS04285 (284650) 284650..284871 + 222 WP_032937236.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
OQW59_RS04290 (284868) 284868..285236 + 369 WP_213168140.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
OQW59_RS04295 (285480) 285480..286796 + 1317 WP_213168142.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
OQW59_RS04300 (286897) 286897..287784 + 888 WP_003837841.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
OQW59_RS04305 (287781) 287781..288626 + 846 WP_003837843.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
OQW59_RS04310 (288629) 288629..289699 + 1071 WP_003837845.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 281372..290439 9067
- inside Prophage - - 274073..290439 16366


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(6-121)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13645.97 Da        Isoelectric Point: 6.9891

>T264466 WP_213168140.1 NZ_CP110894:284868-285236 [Citrobacter freundii]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEALMYRVLNQIEYEGVTDVWLLVAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIVLSANPDFVAMTVEAAAGQLTLEQIAHRLRH

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8306.41 Da        Isoelectric Point: 4.7906

>AT264466 WP_032937236.1 NZ_CP110894:284650-284871 [Citrobacter freundii]
MRTMNYSEARQNLAEVLESAVTGVPVTITRRGHKPAVIISAEEFERYQAARLDDEFADIMMIHGNEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A0J1N092

References