Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 158581..159106 | Replicon | plasmid pCF1807-2 |
| Accession | NZ_CP110892 | ||
| Organism | Citrobacter freundii strain CF1807 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | W8EAA6 |
| Locus tag | OQW59_RS02505 | Protein ID | WP_008322213.1 |
| Coordinates | 158801..159106 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | A0A6C0NE25 |
| Locus tag | OQW59_RS02500 | Protein ID | WP_032934863.1 |
| Coordinates | 158581..158799 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OQW59_RS02470 (OQW59_02465) | 154018..154149 | - | 132 | Protein_175 | 4-hydroxyphenylacetate 3-monooxygenase | - |
| OQW59_RS02475 (OQW59_02470) | 154200..155167 | - | 968 | Protein_176 | IS5 family transposase | - |
| OQW59_RS02480 (OQW59_02475) | 155199..155360 | - | 162 | Protein_177 | UvrD-helicase domain-containing protein | - |
| OQW59_RS02485 (OQW59_02480) | 155353..157009 | - | 1657 | Protein_178 | AAA family ATPase | - |
| OQW59_RS02490 (OQW59_02485) | 157227..157637 | - | 411 | WP_265969926.1 | PIN domain-containing protein | - |
| OQW59_RS02495 (OQW59_02490) | 157634..157864 | - | 231 | WP_265969928.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| OQW59_RS02500 (OQW59_02495) | 158581..158799 | + | 219 | WP_032934863.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| OQW59_RS02505 (OQW59_02500) | 158801..159106 | + | 306 | WP_008322213.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| OQW59_RS02510 (OQW59_02505) | 159108..159422 | + | 315 | WP_008322211.1 | hypothetical protein | - |
| OQW59_RS02515 (OQW59_02510) | 159412..160203 | + | 792 | WP_008322208.1 | site-specific integrase | - |
| OQW59_RS02520 (OQW59_02515) | 160402..161769 | - | 1368 | WP_008322207.1 | GntP family transporter | - |
| OQW59_RS02525 (OQW59_02520) | 161855..162631 | - | 777 | WP_008322204.1 | HPr family phosphocarrier protein | - |
| OQW59_RS02530 (OQW59_02525) | 162636..163274 | - | 639 | WP_008322203.1 | aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaNDM-1 / aac(3)-IId / blaTEM-1B | htpB | 1..211224 | 211224 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11450.23 Da Isoelectric Point: 5.8211
>T264463 WP_008322213.1 NZ_CP110892:158801-159106 [Citrobacter freundii]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLVSARLLSDKVSRELYPVVSVGGDPYRLMTTDMASVPATVIGEEV
ADLSHLENDIQNAINLMFRGI
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLVSARLLSDKVSRELYPVVSVGGDPYRLMTTDMASVPATVIGEEV
ADLSHLENDIQNAINLMFRGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6C0NE27 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6C0NE25 |