Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 158581..159106 Replicon plasmid pCF1807-2
Accession NZ_CP110892
Organism Citrobacter freundii strain CF1807

Toxin (Protein)


Gene name ccdB Uniprot ID W8EAA6
Locus tag OQW59_RS02505 Protein ID WP_008322213.1
Coordinates 158801..159106 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID A0A6C0NE25
Locus tag OQW59_RS02500 Protein ID WP_032934863.1
Coordinates 158581..158799 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OQW59_RS02470 (OQW59_02465) 154018..154149 - 132 Protein_175 4-hydroxyphenylacetate 3-monooxygenase -
OQW59_RS02475 (OQW59_02470) 154200..155167 - 968 Protein_176 IS5 family transposase -
OQW59_RS02480 (OQW59_02475) 155199..155360 - 162 Protein_177 UvrD-helicase domain-containing protein -
OQW59_RS02485 (OQW59_02480) 155353..157009 - 1657 Protein_178 AAA family ATPase -
OQW59_RS02490 (OQW59_02485) 157227..157637 - 411 WP_265969926.1 PIN domain-containing protein -
OQW59_RS02495 (OQW59_02490) 157634..157864 - 231 WP_265969928.1 type II toxin-antitoxin system VapB family antitoxin -
OQW59_RS02500 (OQW59_02495) 158581..158799 + 219 WP_032934863.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
OQW59_RS02505 (OQW59_02500) 158801..159106 + 306 WP_008322213.1 type II toxin-antitoxin system toxin CcdB Toxin
OQW59_RS02510 (OQW59_02505) 159108..159422 + 315 WP_008322211.1 hypothetical protein -
OQW59_RS02515 (OQW59_02510) 159412..160203 + 792 WP_008322208.1 site-specific integrase -
OQW59_RS02520 (OQW59_02515) 160402..161769 - 1368 WP_008322207.1 GntP family transporter -
OQW59_RS02525 (OQW59_02520) 161855..162631 - 777 WP_008322204.1 HPr family phosphocarrier protein -
OQW59_RS02530 (OQW59_02525) 162636..163274 - 639 WP_008322203.1 aldolase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaNDM-1 / aac(3)-IId / blaTEM-1B htpB 1..211224 211224


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11450.23 Da        Isoelectric Point: 5.8211

>T264463 WP_008322213.1 NZ_CP110892:158801-159106 [Citrobacter freundii]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLVSARLLSDKVSRELYPVVSVGGDPYRLMTTDMASVPATVIGEEV
ADLSHLENDIQNAINLMFRGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8297.11 Da        Isoelectric Point: 4.4013

>AT264463 WP_032934863.1 NZ_CP110892:158581-158799 [Citrobacter freundii]
VKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERWQEENREGMAEVASFIEANGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6C0NE27

Antitoxin

Source ID Structure
AlphaFold DB A0A6C0NE25

References