Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /RES-TIGR02293
Location 197087..197988 Replicon plasmid pCF1807-1
Accession NZ_CP110891
Organism Citrobacter freundii strain CF1807

Toxin (Protein)


Gene name - Uniprot ID A0A837LJP8
Locus tag OQW59_RS01420 Protein ID WP_007372300.1
Coordinates 197087..197545 (-) Length 153 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID -
Locus tag OQW59_RS01425 Protein ID WP_008786588.1
Coordinates 197542..197988 (-) Length 149 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OQW59_RS01375 (OQW59_01370) 192768..193055 + 288 WP_016241556.1 hypothetical protein -
OQW59_RS01380 (OQW59_01375) 193066..193464 + 399 WP_007372292.1 hypothetical protein -
OQW59_RS01385 (OQW59_01380) 193548..193874 + 327 WP_007372293.1 hypothetical protein -
OQW59_RS01390 (OQW59_01385) 194237..194575 - 339 WP_007372294.1 hypothetical protein -
OQW59_RS01395 (OQW59_01390) 194813..195256 + 444 WP_007372295.1 hypothetical protein -
OQW59_RS01400 (OQW59_01395) 195375..195716 + 342 WP_007372296.1 hypothetical protein -
OQW59_RS01405 (OQW59_01400) 195875..196429 + 555 WP_047715717.1 hypothetical protein -
OQW59_RS01410 (OQW59_01405) 196479..196745 + 267 WP_007372298.1 hypothetical protein -
OQW59_RS01415 (OQW59_01410) 196813..197043 - 231 WP_007372299.1 hypothetical protein -
OQW59_RS01420 (OQW59_01415) 197087..197545 - 459 WP_007372300.1 RES family NAD+ phosphorylase Toxin
OQW59_RS01425 (OQW59_01420) 197542..197988 - 447 WP_008786588.1 DUF2384 domain-containing protein Antitoxin
OQW59_RS01430 (OQW59_01425) 198137..198454 + 318 WP_007372302.1 hypothetical protein -
OQW59_RS01435 (OQW59_01430) 198496..199338 + 843 WP_007372303.1 hypothetical protein -
OQW59_RS01440 (OQW59_01435) 199310..199588 + 279 WP_007372304.1 hypothetical protein -
OQW59_RS01445 (OQW59_01440) 199648..200091 + 444 WP_007372305.1 hypothetical protein -
OQW59_RS01450 (OQW59_01445) 200378..200542 + 165 WP_007372306.1 hypothetical protein -
OQW59_RS01455 (OQW59_01450) 201110..201952 + 843 WP_007372307.1 HNH endonuclease signature motif containing protein -
OQW59_RS01460 (OQW59_01455) 202374..202625 + 252 WP_024196080.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aac(3)-IIa / fosA3 / aac(6')-Ib-cr / blaOXA-1 / catB3 / ARR-3 / qacE / sul1 / qnrA1 / blaTEM-1B / tet(D) - 1..227029 227029


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

RES domain

(3-148)

Antitoxin

Antitoxin Xre/MbcA/ParS-like, toxin-binding domain

(95-145)


Sequences

Toxin        


Download         Length: 153 a.a.        Molecular weight: 16975.40 Da        Isoelectric Point: 4.5730

>T264460 WP_007372300.1 NZ_CP110891:c197545-197087 [Citrobacter freundii]
VILYRLTKTRYLMTAWSGLGAKEAGGRWNSVGTAMVYLSETASLTMLETLVHIHAPQLLDDFTLLSLDVPDDQIQTFDMS
RLPDNWASEDAPAELALYGDNWAESGSSIALRIPSALSPVEFNYLLNPAHPELFDLMATVKKIPFRFDSRLK

Download         Length: 459 bp

Antitoxin


Download         Length: 149 a.a.        Molecular weight: 16689.02 Da        Isoelectric Point: 6.9812

>AT264460 WP_008786588.1 NZ_CP110891:c197988-197542 [Citrobacter freundii]
MTMKVFSPDVTKTNQHCLWQVAGLDNDGIALMDKINHGLDGTVAKHISEWANITPSELRKMSGIPNTTFNRSIKDRFTAD
QSERLVRIIRVIERAVELFEGDKEAAHKWLNEANRGLSWKSPAELVSSETGALEVMRLITRIEHGVYS

Download         Length: 447 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A837LJP8

Antitoxin

Source ID Structure

References