Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /RES-TIGR02293 |
| Location | 197087..197988 | Replicon | plasmid pCF1807-1 |
| Accession | NZ_CP110891 | ||
| Organism | Citrobacter freundii strain CF1807 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | A0A837LJP8 |
| Locus tag | OQW59_RS01420 | Protein ID | WP_007372300.1 |
| Coordinates | 197087..197545 (-) | Length | 153 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | OQW59_RS01425 | Protein ID | WP_008786588.1 |
| Coordinates | 197542..197988 (-) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OQW59_RS01375 (OQW59_01370) | 192768..193055 | + | 288 | WP_016241556.1 | hypothetical protein | - |
| OQW59_RS01380 (OQW59_01375) | 193066..193464 | + | 399 | WP_007372292.1 | hypothetical protein | - |
| OQW59_RS01385 (OQW59_01380) | 193548..193874 | + | 327 | WP_007372293.1 | hypothetical protein | - |
| OQW59_RS01390 (OQW59_01385) | 194237..194575 | - | 339 | WP_007372294.1 | hypothetical protein | - |
| OQW59_RS01395 (OQW59_01390) | 194813..195256 | + | 444 | WP_007372295.1 | hypothetical protein | - |
| OQW59_RS01400 (OQW59_01395) | 195375..195716 | + | 342 | WP_007372296.1 | hypothetical protein | - |
| OQW59_RS01405 (OQW59_01400) | 195875..196429 | + | 555 | WP_047715717.1 | hypothetical protein | - |
| OQW59_RS01410 (OQW59_01405) | 196479..196745 | + | 267 | WP_007372298.1 | hypothetical protein | - |
| OQW59_RS01415 (OQW59_01410) | 196813..197043 | - | 231 | WP_007372299.1 | hypothetical protein | - |
| OQW59_RS01420 (OQW59_01415) | 197087..197545 | - | 459 | WP_007372300.1 | RES family NAD+ phosphorylase | Toxin |
| OQW59_RS01425 (OQW59_01420) | 197542..197988 | - | 447 | WP_008786588.1 | DUF2384 domain-containing protein | Antitoxin |
| OQW59_RS01430 (OQW59_01425) | 198137..198454 | + | 318 | WP_007372302.1 | hypothetical protein | - |
| OQW59_RS01435 (OQW59_01430) | 198496..199338 | + | 843 | WP_007372303.1 | hypothetical protein | - |
| OQW59_RS01440 (OQW59_01435) | 199310..199588 | + | 279 | WP_007372304.1 | hypothetical protein | - |
| OQW59_RS01445 (OQW59_01440) | 199648..200091 | + | 444 | WP_007372305.1 | hypothetical protein | - |
| OQW59_RS01450 (OQW59_01445) | 200378..200542 | + | 165 | WP_007372306.1 | hypothetical protein | - |
| OQW59_RS01455 (OQW59_01450) | 201110..201952 | + | 843 | WP_007372307.1 | HNH endonuclease signature motif containing protein | - |
| OQW59_RS01460 (OQW59_01455) | 202374..202625 | + | 252 | WP_024196080.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | aac(3)-IIa / fosA3 / aac(6')-Ib-cr / blaOXA-1 / catB3 / ARR-3 / qacE / sul1 / qnrA1 / blaTEM-1B / tet(D) | - | 1..227029 | 227029 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 153 a.a. Molecular weight: 16975.40 Da Isoelectric Point: 4.5730
>T264460 WP_007372300.1 NZ_CP110891:c197545-197087 [Citrobacter freundii]
VILYRLTKTRYLMTAWSGLGAKEAGGRWNSVGTAMVYLSETASLTMLETLVHIHAPQLLDDFTLLSLDVPDDQIQTFDMS
RLPDNWASEDAPAELALYGDNWAESGSSIALRIPSALSPVEFNYLLNPAHPELFDLMATVKKIPFRFDSRLK
VILYRLTKTRYLMTAWSGLGAKEAGGRWNSVGTAMVYLSETASLTMLETLVHIHAPQLLDDFTLLSLDVPDDQIQTFDMS
RLPDNWASEDAPAELALYGDNWAESGSSIALRIPSALSPVEFNYLLNPAHPELFDLMATVKKIPFRFDSRLK
Download Length: 459 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16689.02 Da Isoelectric Point: 6.9812
>AT264460 WP_008786588.1 NZ_CP110891:c197988-197542 [Citrobacter freundii]
MTMKVFSPDVTKTNQHCLWQVAGLDNDGIALMDKINHGLDGTVAKHISEWANITPSELRKMSGIPNTTFNRSIKDRFTAD
QSERLVRIIRVIERAVELFEGDKEAAHKWLNEANRGLSWKSPAELVSSETGALEVMRLITRIEHGVYS
MTMKVFSPDVTKTNQHCLWQVAGLDNDGIALMDKINHGLDGTVAKHISEWANITPSELRKMSGIPNTTFNRSIKDRFTAD
QSERLVRIIRVIERAVELFEGDKEAAHKWLNEANRGLSWKSPAELVSSETGALEVMRLITRIEHGVYS
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|