Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 189788..190338 Replicon plasmid pCF1807-1
Accession NZ_CP110891
Organism Citrobacter freundii strain CF1807

Toxin (Protein)


Gene name ccdB Uniprot ID S1EZ93
Locus tag OQW59_RS01350 Protein ID WP_007372286.1
Coordinates 190030..190338 (+) Length 103 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID S1FMC3
Locus tag OQW59_RS01345 Protein ID WP_007372285.1
Coordinates 189788..190027 (+) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OQW59_RS01300 (OQW59_01295) 184795..185190 + 396 WP_024196081.1 hypothetical protein -
OQW59_RS01305 (OQW59_01300) 185372..185563 + 192 WP_016241560.1 hypothetical protein -
OQW59_RS01310 (OQW59_01305) 185694..186389 + 696 WP_007372278.1 hypothetical protein -
OQW59_RS01315 (OQW59_01310) 186412..186609 + 198 WP_032155220.1 Lar family restriction alleviation protein -
OQW59_RS01320 (OQW59_01315) 186662..187120 + 459 WP_008786599.1 hypothetical protein -
OQW59_RS01325 (OQW59_01320) 187268..187408 + 141 WP_007372281.1 hypothetical protein -
OQW59_RS01330 (OQW59_01325) 187424..188056 + 633 WP_007372282.1 hypothetical protein -
OQW59_RS01335 (OQW59_01330) 188514..189188 + 675 WP_008786597.1 hypothetical protein -
OQW59_RS01340 (OQW59_01335) 189185..189649 + 465 WP_008786596.1 hypothetical protein -
OQW59_RS01345 (OQW59_01340) 189788..190027 + 240 WP_007372285.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
OQW59_RS01350 (OQW59_01345) 190030..190338 + 309 WP_007372286.1 CcdB family protein Toxin
OQW59_RS01355 (OQW59_01350) 190359..190517 + 159 WP_016241558.1 hypothetical protein -
OQW59_RS01360 (OQW59_01355) 190672..191226 + 555 WP_007372288.1 hypothetical protein -
OQW59_RS01365 (OQW59_01360) 191296..191913 + 618 WP_007372289.1 hypothetical protein -
OQW59_RS01370 (OQW59_01365) 191996..192466 + 471 WP_007372290.1 HAD domain-containing protein -
OQW59_RS01375 (OQW59_01370) 192768..193055 + 288 WP_016241556.1 hypothetical protein -
OQW59_RS01380 (OQW59_01375) 193066..193464 + 399 WP_007372292.1 hypothetical protein -
OQW59_RS01385 (OQW59_01380) 193548..193874 + 327 WP_007372293.1 hypothetical protein -
OQW59_RS01390 (OQW59_01385) 194237..194575 - 339 WP_007372294.1 hypothetical protein -
OQW59_RS01395 (OQW59_01390) 194813..195256 + 444 WP_007372295.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aac(3)-IIa / fosA3 / aac(6')-Ib-cr / blaOXA-1 / catB3 / ARR-3 / qacE / sul1 / qnrA1 / blaTEM-1B / tet(D) - 1..227029 227029


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-101)

Antitoxin

Post-segregation antitoxin CcdA

(9-79)


Sequences

Toxin        


Download         Length: 103 a.a.        Molecular weight: 11351.17 Da        Isoelectric Point: 8.5044

>T264459 WP_007372286.1 NZ_CP110891:190030-190338 [Citrobacter freundii]
MQYTVYRNPGNSQAYPYLLDIQSDIIGELNTRLVIPLHRLKKGASAPVARLTPVIQVEGNDVILMTHEMASVRVKQLGQA
VMDASPFRHTIKSAVDFLLDGF

Download         Length: 309 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8784.97 Da        Isoelectric Point: 8.6387

>AT264459 WP_007372285.1 NZ_CP110891:189788-190027 [Citrobacter freundii]
MQATAARQKKTVSVTLEPMLVQQAKDAGINLSATLAEALQSKLKASAAEEWKRQNRAGIQELNRITEEHGLLSDEYRTF

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1EZ93

Antitoxin

Source ID Structure
AlphaFold DB S1FMC3

References