Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2251775..2252403 | Replicon | chromosome |
Accession | NZ_CP110888 | ||
Organism | Thermoanaerobacter sp. RKWS2 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | B0KD57 |
Locus tag | OEI98_RS11840 | Protein ID | WP_003867472.1 |
Coordinates | 2251775..2252125 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | M8DD10 |
Locus tag | OEI98_RS11845 | Protein ID | WP_003870023.1 |
Coordinates | 2252128..2252403 (-) | Length | 92 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OEI98_RS11820 (OEI98_002364) | 2247265..2248002 | - | 738 | WP_003870018.1 | WecB/TagA/CpsF family glycosyltransferase | - |
OEI98_RS11825 (OEI98_002365) | 2248005..2249096 | - | 1092 | WP_003870019.1 | polysaccharide pyruvyl transferase CsaB | - |
OEI98_RS11830 (OEI98_002366) | 2249098..2251110 | - | 2013 | WP_019907959.1 | DUF5693 family protein | - |
OEI98_RS11835 (OEI98_002367) | 2251225..2251677 | - | 453 | WP_003870021.1 | hypothetical protein | - |
OEI98_RS11840 (OEI98_002368) | 2251775..2252125 | - | 351 | WP_003867472.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
OEI98_RS11845 (OEI98_002369) | 2252128..2252403 | - | 276 | WP_003870023.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
OEI98_RS11850 (OEI98_002370) | 2252505..2253659 | - | 1155 | WP_003870024.1 | alanine racemase | - |
OEI98_RS11855 (OEI98_002371) | 2253679..2254695 | - | 1017 | WP_244262740.1 | outer membrane lipoprotein carrier protein LolA | - |
OEI98_RS11860 (OEI98_002372) | 2254700..2256232 | - | 1533 | WP_003870026.1 | NAD(P)H-hydrate dehydratase | - |
OEI98_RS11865 (OEI98_002373) | 2256195..2256611 | - | 417 | WP_003870027.1 | holo-ACP synthase | - |
OEI98_RS11870 (OEI98_002374) | 2256707..2257072 | - | 366 | WP_003867466.1 | DUF6514 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12933.02 Da Isoelectric Point: 6.4714
>T264457 WP_003867472.1 NZ_CP110888:c2252125-2251775 [Thermoanaerobacter sp. RKWS2]
MVIKRGDIFYADLSPVIGSEQGGIRPVLIIQNDIGNKYSPTVIVAAITSQINKAKLPTHVEINGAEYGLNKDSVVLLEQI
RTIDKKRLREKIGHFDQEMMEKVNEALQISLGLIDF
MVIKRGDIFYADLSPVIGSEQGGIRPVLIIQNDIGNKYSPTVIVAAITSQINKAKLPTHVEINGAEYGLNKDSVVLLEQI
RTIDKKRLREKIGHFDQEMMEKVNEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0B3BRL3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | M8DD10 |