Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 3927751..3928368 | Replicon | chromosome |
Accession | NZ_CP110887 | ||
Organism | Dickeya solani strain DsR207 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | C6CDL0 |
Locus tag | OQ522_RS17115 | Protein ID | WP_012764944.1 |
Coordinates | 3928189..3928368 (-) | Length | 60 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | A0A2K8W4Y6 |
Locus tag | OQ522_RS17110 | Protein ID | WP_022633005.1 |
Coordinates | 3927751..3928161 (-) | Length | 137 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OQ522_RS17085 (OQ522_07845) | 3923251..3924168 | + | 918 | WP_023637727.1 | iron-siderophore ABC transporter substrate-binding protein | - |
OQ522_RS17090 (OQ522_07850) | 3924165..3925187 | + | 1023 | WP_022633001.1 | iron ABC transporter permease | - |
OQ522_RS17095 (OQ522_07855) | 3925180..3926229 | + | 1050 | WP_022633002.1 | iron ABC transporter permease | - |
OQ522_RS17100 (OQ522_07860) | 3926241..3927086 | + | 846 | WP_023637730.1 | ABC transporter ATP-binding protein | - |
OQ522_RS17105 (OQ522_07865) | 3927083..3927748 | + | 666 | WP_022633004.1 | RraA family protein | - |
OQ522_RS17110 (OQ522_07870) | 3927751..3928161 | - | 411 | WP_022633005.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
OQ522_RS17115 (OQ522_07875) | 3928189..3928368 | - | 180 | WP_012764944.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
OQ522_RS17120 (OQ522_07880) | 3928690..3929052 | + | 363 | WP_071598627.1 | hypothetical protein | - |
OQ522_RS17125 (OQ522_07885) | 3929388..3930443 | - | 1056 | WP_022633006.1 | MBL fold metallo-hydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6530.61 Da Isoelectric Point: 10.7838
>T264449 WP_012764944.1 NZ_CP110887:c3928368-3928189 [Dickeya solani]
MDSRTLIAEIKADGWELVRVNGSHHHFTHPTKPGLVTIPHPKKDLPIGTVKSIRKQAGI
MDSRTLIAEIKADGWELVRVNGSHHHFTHPTKPGLVTIPHPKKDLPIGTVKSIRKQAGI
Download Length: 180 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 14499.48 Da Isoelectric Point: 4.3391
>AT264449 WP_022633005.1 NZ_CP110887:c3928161-3927751 [Dickeya solani]
MFYPIAIEAGDDTHAYGVTVPDLPGCFSAGDTLDEAIANAKDAITGHIELLIEMGQDIPAVSSVGTLAKAPEYTGYTWAV
VDIDVTRLMGGAEKINVTLPKSLIDRIDRCVASNPEFKSRSGFLAQAALERISSIR
MFYPIAIEAGDDTHAYGVTVPDLPGCFSAGDTLDEAIANAKDAITGHIELLIEMGQDIPAVSSVGTLAKAPEYTGYTWAV
VDIDVTRLMGGAEKINVTLPKSLIDRIDRCVASNPEFKSRSGFLAQAALERISSIR
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2K8W4W9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2K8W4Y6 |