Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3382721..3383346 | Replicon | chromosome |
Accession | NZ_CP110887 | ||
Organism | Dickeya solani strain DsR207 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | A0A2K8W3K4 |
Locus tag | OQ522_RS14840 | Protein ID | WP_022632574.1 |
Coordinates | 3382721..3382924 (-) | Length | 68 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | A0A2K8W3I1 |
Locus tag | OQ522_RS14845 | Protein ID | WP_022632575.1 |
Coordinates | 3382978..3383346 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OQ522_RS14810 (OQ522_05565) | 3378361..3378699 | + | 339 | WP_002208627.1 | P-II family nitrogen regulator | - |
OQ522_RS14815 (OQ522_05570) | 3378742..3380034 | + | 1293 | WP_022632570.1 | ammonium transporter AmtB | - |
OQ522_RS14820 (OQ522_05575) | 3380130..3380993 | - | 864 | WP_022632571.1 | acyl-CoA thioesterase II | - |
OQ522_RS14825 (OQ522_05580) | 3381245..3381802 | + | 558 | WP_022632572.1 | YbaY family lipoprotein | - |
OQ522_RS14830 (OQ522_05585) | 3381831..3382160 | - | 330 | WP_022632573.1 | MGMT family protein | - |
OQ522_RS14840 (OQ522_05595) | 3382721..3382924 | - | 204 | WP_022632574.1 | HHA domain-containing protein | Toxin |
OQ522_RS14845 (OQ522_05600) | 3382978..3383346 | - | 369 | WP_022632575.1 | Hha toxicity modulator TomB | Antitoxin |
OQ522_RS14850 (OQ522_05605) | 3383854..3383997 | - | 144 | WP_022632576.1 | type B 50S ribosomal protein L36 | - |
OQ522_RS14855 (OQ522_05610) | 3384013..3384264 | - | 252 | WP_022632577.1 | type B 50S ribosomal protein L31 | - |
OQ522_RS14860 (OQ522_05615) | 3384441..3387587 | - | 3147 | WP_022632578.1 | efflux RND transporter permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8161.52 Da Isoelectric Point: 8.8580
>T264447 WP_022632574.1 NZ_CP110887:c3382924-3382721 [Dickeya solani]
MKKIDYLMRLRKCTTIDTLERVIEKNKYELSNDELEMFYSAADHRLAELTMNKLYDKVPTAVWRYVR
MKKIDYLMRLRKCTTIDTLERVIEKNKYELSNDELEMFYSAADHRLAELTMNKLYDKVPTAVWRYVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14223.06 Da Isoelectric Point: 5.1663
>AT264447 WP_022632575.1 NZ_CP110887:c3383346-3382978 [Dickeya solani]
MDEYTPQHYDIAQLRFLCENLHDESIATLGDSSHGWVNDPTSAVNLQLNELIEHIAAFVVTYKIKYPHEAALCERVEKYL
DDTYILFSNYGINDTELRKWQKSKSQLFRMFSEKSICTVVKT
MDEYTPQHYDIAQLRFLCENLHDESIATLGDSSHGWVNDPTSAVNLQLNELIEHIAAFVVTYKIKYPHEAALCERVEKYL
DDTYILFSNYGINDTELRKWQKSKSQLFRMFSEKSICTVVKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2K8W3K4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2K8W3I1 |