Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 2894472..2895150 | Replicon | chromosome |
Accession | NZ_CP110887 | ||
Organism | Dickeya solani strain DsR207 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | OQ522_RS12700 | Protein ID | WP_023637601.1 |
Coordinates | 2894719..2895150 (+) | Length | 144 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | A0A2K8QSU7 |
Locus tag | OQ522_RS12695 | Protein ID | WP_023637600.1 |
Coordinates | 2894472..2894738 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OQ522_RS12675 (OQ522_03430) | 2890922..2891572 | + | 651 | WP_022632163.1 | LysE family translocator | - |
OQ522_RS12680 (OQ522_03435) | 2891643..2892251 | - | 609 | WP_022632164.1 | HD domain-containing protein | - |
OQ522_RS12685 (OQ522_03440) | 2892461..2893111 | + | 651 | WP_022632165.1 | hemolysin III family protein | - |
OQ522_RS12690 (OQ522_03445) | 2893185..2894165 | - | 981 | WP_022632166.1 | tRNA-modifying protein YgfZ | - |
OQ522_RS12695 (OQ522_03450) | 2894472..2894738 | + | 267 | WP_023637600.1 | FAD assembly factor SdhE | Antitoxin |
OQ522_RS12700 (OQ522_03455) | 2894719..2895150 | + | 432 | WP_023637601.1 | protein YgfX | Toxin |
OQ522_RS12705 (OQ522_03460) | 2895250..2895768 | - | 519 | WP_022632169.1 | flavodoxin FldB | - |
OQ522_RS12710 (OQ522_03465) | 2895897..2897222 | - | 1326 | WP_022632170.1 | MFS transporter | - |
OQ522_RS12715 (OQ522_03470) | 2897485..2898384 | + | 900 | WP_022632171.1 | site-specific tyrosine recombinase XerD | - |
OQ522_RS12720 (OQ522_03475) | 2898474..2899181 | + | 708 | WP_022632172.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 144 a.a. Molecular weight: 16808.51 Da Isoelectric Point: 11.7737
>T264446 WP_023637601.1 NZ_CP110887:2894719-2895150 [Dickeya solani]
VAQWQCDLRVSWRMQLFSLLTHGFLVLMILLAPWPDGYAPLWLGLVTLVVFGFVRSQRIIKSRQGEISLHGENQLHWQQR
DWQIARRPWVMRNGVLLSLRATTGKGHQRLWLASDSMGNEEWRLLRQLLQQHPLQGTESSRHH
VAQWQCDLRVSWRMQLFSLLTHGFLVLMILLAPWPDGYAPLWLGLVTLVVFGFVRSQRIIKSRQGEISLHGENQLHWQQR
DWQIARRPWVMRNGVLLSLRATTGKGHQRLWLASDSMGNEEWRLLRQLLQQHPLQGTESSRHH
Download Length: 432 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|