Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 2758440..2758966 | Replicon | chromosome |
Accession | NZ_CP110887 | ||
Organism | Dickeya solani strain DsR207 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | A0A2K8W1W4 |
Locus tag | OQ522_RS12040 | Protein ID | WP_022632051.1 |
Coordinates | 2758440..2758745 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | A0A2K8W1V7 |
Locus tag | OQ522_RS12045 | Protein ID | WP_022632052.1 |
Coordinates | 2758748..2758966 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OQ522_RS12020 (OQ522_02775) | 2753656..2754053 | + | 398 | Protein_2327 | DUF3577 domain-containing protein | - |
OQ522_RS12025 (OQ522_02780) | 2754169..2755440 | + | 1272 | WP_022632048.1 | hypothetical protein | - |
OQ522_RS12030 (OQ522_02785) | 2755444..2756022 | + | 579 | WP_023637591.1 | hypothetical protein | - |
OQ522_RS12035 (OQ522_02790) | 2756010..2757950 | + | 1941 | WP_022632050.1 | hypothetical protein | - |
OQ522_RS12040 (OQ522_02795) | 2758440..2758745 | - | 306 | WP_022632051.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
OQ522_RS12045 (OQ522_02800) | 2758748..2758966 | - | 219 | WP_022632052.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
OQ522_RS12050 (OQ522_02805) | 2759025..2759768 | - | 744 | WP_022632053.1 | MobC family replication-relaxation protein | - |
OQ522_RS12055 (OQ522_02810) | 2760671..2761021 | - | 351 | WP_013316250.1 | hypothetical protein | - |
OQ522_RS12060 (OQ522_02815) | 2761144..2761332 | + | 189 | WP_033111580.1 | hypothetical protein | - |
OQ522_RS12065 (OQ522_02820) | 2761472..2762731 | - | 1260 | WP_022632055.1 | integrase arm-type DNA-binding domain-containing protein | - |
OQ522_RS12075 (OQ522_02830) | 2763129..2763704 | - | 576 | WP_022632056.1 | transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 2752577..2762908 | 10331 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11779.68 Da Isoelectric Point: 4.8837
>T264445 WP_022632051.1 NZ_CP110887:c2758745-2758440 [Dickeya solani]
MQFIVYEYKRASHYKMFVDVQSDIVETPKRRMVIPLIEAHHLSEKVNKTLFPKIRIDGEDYRLMTTELSSVPVEVMGEVI
ADLGDYADEIKDAINLMFWGI
MQFIVYEYKRASHYKMFVDVQSDIVETPKRRMVIPLIEAHHLSEKVNKTLFPKIRIDGEDYRLMTTELSSVPVEVMGEVI
ADLGDYADEIKDAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2K8W1W4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2K8W1V7 |