Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
Location | 4877135..4877730 | Replicon | chromosome |
Accession | NZ_CP110886 | ||
Organism | Dickeya solani strain DsR34 |
Toxin (Protein)
Gene name | doc | Uniprot ID | E0SEA8 |
Locus tag | OQ520_RS21230 | Protein ID | WP_013318177.1 |
Coordinates | 4877135..4877512 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | A0A2K8VUJ6 |
Locus tag | OQ520_RS21235 | Protein ID | WP_022633800.1 |
Coordinates | 4877509..4877730 (-) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OQ520_RS21210 (OQ520_11965) | 4872801..4873067 | + | 267 | WP_022633797.1 | hypothetical protein | - |
OQ520_RS21215 (OQ520_11970) | 4873299..4873481 | + | 183 | WP_072142890.1 | hypothetical protein | - |
OQ520_RS21220 (OQ520_11975) | 4873563..4875329 | - | 1767 | WP_022633798.1 | ATP-binding protein | - |
OQ520_RS21225 (OQ520_11980) | 4875319..4876497 | - | 1179 | WP_022633799.1 | hypothetical protein | - |
OQ520_RS21230 (OQ520_11985) | 4877135..4877512 | - | 378 | WP_013318177.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
OQ520_RS21235 (OQ520_11990) | 4877509..4877730 | - | 222 | WP_022633800.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
OQ520_RS21240 (OQ520_11995) | 4877871..4879019 | - | 1149 | WP_022633801.1 | L-threonine dehydrogenase | - |
OQ520_RS21245 (OQ520_12000) | 4879406..4879861 | + | 456 | WP_022633802.1 | NUDIX domain-containing protein | - |
OQ520_RS21250 (OQ520_12005) | 4879933..4880610 | - | 678 | WP_022633803.1 | respiratory nitrate reductase subunit gamma | - |
OQ520_RS21255 (OQ520_12010) | 4880610..4881329 | - | 720 | WP_022633804.1 | nitrate reductase molybdenum cofactor assembly chaperone | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4868691..4877730 | 9039 | |
- | inside | Prophage | - | - | 4863357..4918696 | 55339 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14320.39 Da Isoelectric Point: 4.9309
>T264441 WP_013318177.1 NZ_CP110886:c4877512-4877135 [Dickeya solani]
MKWVSAQDVIDFHDRILQVLPGVVGMADPGRAEELIYRVQNRLYYEGVTELFELAATYWVTIARGHIFNDGNKRTAFFVT
MTFLRRNGILIVDNDNSLEELTIKAATGECLVSELAEQLRQRVEK
MKWVSAQDVIDFHDRILQVLPGVVGMADPGRAEELIYRVQNRLYYEGVTELFELAATYWVTIARGHIFNDGNKRTAFFVT
MTFLRRNGILIVDNDNSLEELTIKAATGECLVSELAEQLRQRVEK
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | E0SEA8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2K8VUJ6 |