Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 4042583..4043136 | Replicon | chromosome |
Accession | NZ_CP110886 | ||
Organism | Dickeya solani strain DsR34 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | - |
Locus tag | OQ520_RS17620 | Protein ID | WP_022633101.1 |
Coordinates | 4042822..4043136 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | A0A2K8W593 |
Locus tag | OQ520_RS17615 | Protein ID | WP_022633100.1 |
Coordinates | 4042583..4042819 (+) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OQ520_RS17595 (OQ520_08350) | 4038159..4039808 | + | 1650 | WP_022633097.1 | response regulator receiver domain | - |
OQ520_RS17600 (OQ520_08355) | 4040169..4040570 | - | 402 | WP_023637748.1 | hypothetical protein | - |
OQ520_RS17605 (OQ520_08360) | 4040634..4040927 | - | 294 | WP_146053334.1 | hypothetical protein | - |
OQ520_RS17610 (OQ520_08365) | 4041318..4042262 | + | 945 | WP_022633099.1 | zincin-like metallopeptidase domain-containing protein | - |
OQ520_RS17615 (OQ520_08370) | 4042583..4042819 | + | 237 | WP_022633100.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
OQ520_RS17620 (OQ520_08375) | 4042822..4043136 | + | 315 | WP_022633101.1 | CcdB family protein | Toxin |
OQ520_RS17625 (OQ520_08380) | 4043250..4043339 | - | 90 | Protein_3424 | mobilization protein mobC | - |
OQ520_RS17630 (OQ520_08385) | 4043566..4044876 | - | 1311 | WP_223849471.1 | type II toxin-antitoxin system HipA family toxin | - |
OQ520_RS17635 (OQ520_08390) | 4044873..4045280 | - | 408 | WP_071598628.1 | helix-turn-helix transcriptional regulator | - |
OQ520_RS17640 (OQ520_08395) | 4045663..4046409 | - | 747 | WP_022633104.1 | MobC family replication-relaxation protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | hcp | 4033600..4081978 | 48378 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11459.38 Da Isoelectric Point: 7.9859
>T264435 WP_022633101.1 NZ_CP110886:4042822-4043136 [Dickeya solani]
MQFTVYGNTGKSAVYPLLLDVTSDIIGQLNRRIVIPLLPVEKYPAGRRPDRLVPVVRLTDGKEYAVMTHELASIPVQALG
AVFCDASQYRTQVKAAIDFLIDGI
MQFTVYGNTGKSAVYPLLLDVTSDIIGQLNRRIVIPLLPVEKYPAGRRPDRLVPVVRLTDGKEYAVMTHELASIPVQALG
AVFCDASQYRTQVKAAIDFLIDGI
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|