Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3382776..3383401 | Replicon | chromosome |
Accession | NZ_CP110886 | ||
Organism | Dickeya solani strain DsR34 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | A0A2K8W3K4 |
Locus tag | OQ520_RS14840 | Protein ID | WP_022632574.1 |
Coordinates | 3382776..3382979 (-) | Length | 68 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | A0A2K8W3I1 |
Locus tag | OQ520_RS14845 | Protein ID | WP_022632575.1 |
Coordinates | 3383033..3383401 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OQ520_RS14810 (OQ520_05565) | 3378416..3378754 | + | 339 | WP_002208627.1 | P-II family nitrogen regulator | - |
OQ520_RS14815 (OQ520_05570) | 3378797..3380089 | + | 1293 | WP_022632570.1 | ammonium transporter AmtB | - |
OQ520_RS14820 (OQ520_05575) | 3380185..3381048 | - | 864 | WP_022632571.1 | acyl-CoA thioesterase II | - |
OQ520_RS14825 (OQ520_05580) | 3381300..3381857 | + | 558 | WP_022632572.1 | YbaY family lipoprotein | - |
OQ520_RS14830 (OQ520_05585) | 3381886..3382215 | - | 330 | WP_022632573.1 | MGMT family protein | - |
OQ520_RS14840 (OQ520_05595) | 3382776..3382979 | - | 204 | WP_022632574.1 | HHA domain-containing protein | Toxin |
OQ520_RS14845 (OQ520_05600) | 3383033..3383401 | - | 369 | WP_022632575.1 | Hha toxicity modulator TomB | Antitoxin |
OQ520_RS14850 (OQ520_05605) | 3383909..3384052 | - | 144 | WP_022632576.1 | type B 50S ribosomal protein L36 | - |
OQ520_RS14855 (OQ520_05610) | 3384068..3384319 | - | 252 | WP_022632577.1 | type B 50S ribosomal protein L31 | - |
OQ520_RS14860 (OQ520_05615) | 3384496..3387642 | - | 3147 | WP_022632578.1 | efflux RND transporter permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8161.52 Da Isoelectric Point: 8.8580
>T264432 WP_022632574.1 NZ_CP110886:c3382979-3382776 [Dickeya solani]
MKKIDYLMRLRKCTTIDTLERVIEKNKYELSNDELEMFYSAADHRLAELTMNKLYDKVPTAVWRYVR
MKKIDYLMRLRKCTTIDTLERVIEKNKYELSNDELEMFYSAADHRLAELTMNKLYDKVPTAVWRYVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14223.06 Da Isoelectric Point: 5.1663
>AT264432 WP_022632575.1 NZ_CP110886:c3383401-3383033 [Dickeya solani]
MDEYTPQHYDIAQLRFLCENLHDESIATLGDSSHGWVNDPTSAVNLQLNELIEHIAAFVVTYKIKYPHEAALCERVEKYL
DDTYILFSNYGINDTELRKWQKSKSQLFRMFSEKSICTVVKT
MDEYTPQHYDIAQLRFLCENLHDESIATLGDSSHGWVNDPTSAVNLQLNELIEHIAAFVVTYKIKYPHEAALCERVEKYL
DDTYILFSNYGINDTELRKWQKSKSQLFRMFSEKSICTVVKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2K8W3K4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2K8W3I1 |