Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 2894527..2895205 | Replicon | chromosome |
| Accession | NZ_CP110886 | ||
| Organism | Dickeya solani strain DsR34 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | OQ520_RS12700 | Protein ID | WP_023637601.1 |
| Coordinates | 2894774..2895205 (+) | Length | 144 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A2K8QSU7 |
| Locus tag | OQ520_RS12695 | Protein ID | WP_023637600.1 |
| Coordinates | 2894527..2894793 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OQ520_RS12675 (OQ520_03430) | 2890977..2891627 | + | 651 | WP_022632163.1 | LysE family translocator | - |
| OQ520_RS12680 (OQ520_03435) | 2891698..2892306 | - | 609 | WP_022632164.1 | HD domain-containing protein | - |
| OQ520_RS12685 (OQ520_03440) | 2892516..2893166 | + | 651 | WP_022632165.1 | hemolysin III family protein | - |
| OQ520_RS12690 (OQ520_03445) | 2893240..2894220 | - | 981 | WP_022632166.1 | tRNA-modifying protein YgfZ | - |
| OQ520_RS12695 (OQ520_03450) | 2894527..2894793 | + | 267 | WP_023637600.1 | FAD assembly factor SdhE | Antitoxin |
| OQ520_RS12700 (OQ520_03455) | 2894774..2895205 | + | 432 | WP_023637601.1 | protein YgfX | Toxin |
| OQ520_RS12705 (OQ520_03460) | 2895305..2895823 | - | 519 | WP_022632169.1 | flavodoxin FldB | - |
| OQ520_RS12710 (OQ520_03465) | 2895952..2897277 | - | 1326 | WP_022632170.1 | MFS transporter | - |
| OQ520_RS12715 (OQ520_03470) | 2897540..2898439 | + | 900 | WP_022632171.1 | site-specific tyrosine recombinase XerD | - |
| OQ520_RS12720 (OQ520_03475) | 2898529..2899236 | + | 708 | WP_022632172.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 144 a.a. Molecular weight: 16808.51 Da Isoelectric Point: 11.7737
>T264431 WP_023637601.1 NZ_CP110886:2894774-2895205 [Dickeya solani]
VAQWQCDLRVSWRMQLFSLLTHGFLVLMILLAPWPDGYAPLWLGLVTLVVFGFVRSQRIIKSRQGEISLHGENQLHWQQR
DWQIARRPWVMRNGVLLSLRATTGKGHQRLWLASDSMGNEEWRLLRQLLQQHPLQGTESSRHH
VAQWQCDLRVSWRMQLFSLLTHGFLVLMILLAPWPDGYAPLWLGLVTLVVFGFVRSQRIIKSRQGEISLHGENQLHWQQR
DWQIARRPWVMRNGVLLSLRATTGKGHQRLWLASDSMGNEEWRLLRQLLQQHPLQGTESSRHH
Download Length: 432 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|