Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 2758495..2759021 | Replicon | chromosome |
| Accession | NZ_CP110886 | ||
| Organism | Dickeya solani strain DsR34 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | A0A2K8W1W4 |
| Locus tag | OQ520_RS12040 | Protein ID | WP_022632051.1 |
| Coordinates | 2758495..2758800 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | A0A2K8W1V7 |
| Locus tag | OQ520_RS12045 | Protein ID | WP_022632052.1 |
| Coordinates | 2758803..2759021 (-) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OQ520_RS12020 (OQ520_02775) | 2753711..2754108 | + | 398 | Protein_2327 | DUF3577 domain-containing protein | - |
| OQ520_RS12025 (OQ520_02780) | 2754224..2755495 | + | 1272 | WP_022632048.1 | hypothetical protein | - |
| OQ520_RS12030 (OQ520_02785) | 2755499..2756077 | + | 579 | WP_023637591.1 | hypothetical protein | - |
| OQ520_RS12035 (OQ520_02790) | 2756065..2758005 | + | 1941 | WP_022632050.1 | hypothetical protein | - |
| OQ520_RS12040 (OQ520_02795) | 2758495..2758800 | - | 306 | WP_022632051.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| OQ520_RS12045 (OQ520_02800) | 2758803..2759021 | - | 219 | WP_022632052.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| OQ520_RS12050 (OQ520_02805) | 2759080..2759823 | - | 744 | WP_022632053.1 | MobC family replication-relaxation protein | - |
| OQ520_RS12055 (OQ520_02810) | 2760726..2761076 | - | 351 | WP_013316250.1 | hypothetical protein | - |
| OQ520_RS12060 (OQ520_02815) | 2761199..2761387 | + | 189 | WP_033111580.1 | hypothetical protein | - |
| OQ520_RS12065 (OQ520_02820) | 2761527..2762786 | - | 1260 | WP_022632055.1 | integrase arm-type DNA-binding domain-containing protein | - |
| OQ520_RS12075 (OQ520_02830) | 2763184..2763759 | - | 576 | WP_022632056.1 | transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 2752632..2762963 | 10331 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11779.68 Da Isoelectric Point: 4.8837
>T264430 WP_022632051.1 NZ_CP110886:c2758800-2758495 [Dickeya solani]
MQFIVYEYKRASHYKMFVDVQSDIVETPKRRMVIPLIEAHHLSEKVNKTLFPKIRIDGEDYRLMTTELSSVPVEVMGEVI
ADLGDYADEIKDAINLMFWGI
MQFIVYEYKRASHYKMFVDVQSDIVETPKRRMVIPLIEAHHLSEKVNKTLFPKIRIDGEDYRLMTTELSSVPVEVMGEVI
ADLGDYADEIKDAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2K8W1W4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2K8W1V7 |