Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 2752875..2753659 | Replicon | chromosome |
Accession | NZ_CP110886 | ||
Organism | Dickeya solani strain DsR34 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | - |
Locus tag | OQ520_RS12015 | Protein ID | WP_022632047.1 |
Coordinates | 2753165..2753659 (+) | Length | 165 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | A0A2K8W1V4 |
Locus tag | OQ520_RS12010 | Protein ID | WP_022632046.1 |
Coordinates | 2752875..2753168 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OQ520_RS11990 (OQ520_02745) | 2748701..2749153 | + | 453 | WP_022632042.1 | hypothetical protein | - |
OQ520_RS11995 (OQ520_02750) | 2749196..2749492 | + | 297 | WP_022632043.1 | YciI family protein | - |
OQ520_RS12000 (OQ520_02755) | 2749520..2750227 | + | 708 | WP_022632044.1 | SDR family oxidoreductase | - |
OQ520_RS12005 (OQ520_02760) | 2751219..2752470 | - | 1252 | Protein_2324 | tyrosine-type recombinase/integrase | - |
OQ520_RS12010 (OQ520_02765) | 2752875..2753168 | + | 294 | WP_022632046.1 | DUF1778 domain-containing protein | Antitoxin |
OQ520_RS12015 (OQ520_02770) | 2753165..2753659 | + | 495 | WP_022632047.1 | GNAT family N-acetyltransferase | Toxin |
OQ520_RS12020 (OQ520_02775) | 2753711..2754108 | + | 398 | Protein_2327 | DUF3577 domain-containing protein | - |
OQ520_RS12025 (OQ520_02780) | 2754224..2755495 | + | 1272 | WP_022632048.1 | hypothetical protein | - |
OQ520_RS12030 (OQ520_02785) | 2755499..2756077 | + | 579 | WP_023637591.1 | hypothetical protein | - |
OQ520_RS12035 (OQ520_02790) | 2756065..2758005 | + | 1941 | WP_022632050.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 2752632..2762963 | 10331 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 165 a.a. Molecular weight: 17639.41 Da Isoelectric Point: 6.8524
>T264429 WP_022632047.1 NZ_CP110886:2753165-2753659 [Dickeya solani]
MISAPEPLHAEHVLSSFCCGVESMDNWLKQRAMKNQVTGASRTFVSCDDSRVLAYYSLASSAVATTAAPGRFRRNMPDPI
PVVVLGRLAVDTSLHGQGVGRALVRDAGLRVIQVADTIGIRGMLVHALSDEARDFYLRVGFEPSPIDPMILMVTLGDLVG
SLSI
MISAPEPLHAEHVLSSFCCGVESMDNWLKQRAMKNQVTGASRTFVSCDDSRVLAYYSLASSAVATTAAPGRFRRNMPDPI
PVVVLGRLAVDTSLHGQGVGRALVRDAGLRVIQVADTIGIRGMLVHALSDEARDFYLRVGFEPSPIDPMILMVTLGDLVG
SLSI
Download Length: 495 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|