Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 16914..17557 Replicon plasmid pMCR10_SCLZS19
Accession NZ_CP110881
Organism Enterobacter kobei strain SCLZS19

Toxin (Protein)


Gene name vagD Uniprot ID A0A155IU92
Locus tag OQE50_RS27025 Protein ID WP_000754567.1
Coordinates 16914..17330 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID A0A155IUD1
Locus tag OQE50_RS27030 Protein ID WP_023293777.1
Coordinates 17327..17557 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OQE50_RS26995 (OQE50_26995) 12100..12681 + 582 WP_008502230.1 TetR/AcrR family transcriptional regulator -
OQE50_RS27000 (OQE50_27000) 12686..13024 + 339 WP_000888080.1 carboxymuconolactone decarboxylase family protein -
OQE50_RS27005 (OQE50_27005) 13054..13383 - 330 WP_008502229.1 thioredoxin family protein -
OQE50_RS27010 (OQE50_27010) 13596..14702 + 1107 WP_006687059.1 alkene reductase -
OQE50_RS27015 (OQE50_27015) 14768..15469 + 702 WP_008502228.1 DsbA family oxidoreductase -
OQE50_RS27020 (OQE50_27020) 15595..16563 + 969 WP_084832609.1 IS5-like element IS903B family transposase -
OQE50_RS27025 (OQE50_27025) 16914..17330 - 417 WP_000754567.1 type II toxin-antitoxin system VapC family toxin Toxin
OQE50_RS27030 (OQE50_27030) 17327..17557 - 231 WP_023293777.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
OQE50_RS27035 (OQE50_27035) 17695..18249 + 555 WP_161646454.1 hypothetical protein -
OQE50_RS27040 (OQE50_27040) 18337..18408 - 72 Protein_23 hypothetical protein -
OQE50_RS27045 (OQE50_27045) 18538..19743 + 1206 WP_006797591.1 AAA family ATPase -
OQE50_RS27050 (OQE50_27050) 19743..20717 + 975 WP_000064119.1 ParB family protein -
OQE50_RS27055 (OQE50_27055) 20799..22070 - 1272 WP_032627083.1 Y-family DNA polymerase -
OQE50_RS27060 (OQE50_27060) 22070..22501 - 432 WP_006796638.1 translesion error-prone DNA polymerase V autoproteolytic subunit -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid mcr-10 - 1..118766 118766
- inside IScluster/Tn - - 2813..16563 13750


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15108.61 Da        Isoelectric Point: 8.5403

>T264426 WP_000754567.1 NZ_CP110881:c17330-16914 [Enterobacter kobei]
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPGLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8706.73 Da        Isoelectric Point: 4.4299

>AT264426 WP_023293777.1 NZ_CP110881:c17557-17327 [Enterobacter kobei]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAQREDVVSDEGRFDP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A155IU92

Antitoxin

Source ID Structure
AlphaFold DB A0A155IUD1

References