Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 6119..6855 | Replicon | plasmid pMCR10_SCLZS19 |
Accession | NZ_CP110881 | ||
Organism | Enterobacter kobei strain SCLZS19 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | L7SZ15 |
Locus tag | OQE50_RS26960 | Protein ID | WP_003026803.1 |
Coordinates | 6373..6855 (+) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | L7SZ29 |
Locus tag | OQE50_RS26955 | Protein ID | WP_003026799.1 |
Coordinates | 6119..6385 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OQE50_RS26930 (OQE50_26930) | 1709..2449 | - | 741 | WP_001515717.1 | tyrosine-type recombinase/integrase | - |
OQE50_RS26935 (OQE50_26935) | 2813..3781 | - | 969 | WP_023307223.1 | IS5-like element IS903B family transposase | - |
OQE50_RS26940 (OQE50_26940) | 4026..4229 | + | 204 | WP_004213596.1 | HHA domain-containing protein | - |
OQE50_RS26945 (OQE50_26945) | 4243..4473 | + | 231 | WP_023307222.1 | hypothetical protein | - |
OQE50_RS26950 (OQE50_26950) | 4549..5529 | + | 981 | WP_000082736.1 | IS5-like element ISEc68 family transposase | - |
OQE50_RS26955 (OQE50_26955) | 6119..6385 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
OQE50_RS26960 (OQE50_26960) | 6373..6855 | + | 483 | WP_003026803.1 | GNAT family N-acetyltransferase | Toxin |
OQE50_RS26965 (OQE50_26965) | 7067..8410 | + | 1344 | WP_080339306.1 | ISNCY family transposase | - |
OQE50_RS26970 (OQE50_26970) | 8481..9299 | - | 819 | WP_023307220.1 | abortive infection family protein | - |
OQE50_RS26975 (OQE50_26975) | 9308..9880 | - | 573 | WP_032676095.1 | recombinase family protein | - |
OQE50_RS26980 (OQE50_26980) | 10220..10924 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
OQE50_RS26985 (OQE50_26985) | 10958..11216 | + | 259 | Protein_12 | recombinase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | mcr-10 | - | 1..118766 | 118766 | |
- | inside | IScluster/Tn | - | - | 2813..16563 | 13750 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17353.97 Da Isoelectric Point: 9.5822
>T264425 WP_003026803.1 NZ_CP110881:6373-6855 [Enterobacter kobei]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J2GNW6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q8YL66 |