Detailed information of TA system
Overview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3896336..3896993 | Replicon | chromosome |
Accession | NZ_CP110873 | ||
Organism | Enterobacter kobei strain SCLZS19 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A2W0G6Z0 |
Locus tag | OQE50_RS18845 | Protein ID | WP_014885136.1 |
Coordinates | 3896336..3896746 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | V3PWU7 |
Locus tag | OQE50_RS18850 | Protein ID | WP_010435322.1 |
Coordinates | 3896727..3896993 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OQE50_RS18825 (3892330) | 3892330..3894063 | - | 1734 | WP_032635612.1 | single-stranded-DNA-specific exonuclease RecJ | - |
OQE50_RS18830 (3894069) | 3894069..3894782 | - | 714 | WP_266071585.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
OQE50_RS18835 (3894811) | 3894811..3895707 | - | 897 | WP_014885134.1 | site-specific tyrosine recombinase XerD | - |
OQE50_RS18840 (3895809) | 3895809..3896330 | + | 522 | WP_071922917.1 | flavodoxin FldB | - |
OQE50_RS18845 (3896336) | 3896336..3896746 | - | 411 | WP_014885136.1 | protein YgfX | Toxin |
OQE50_RS18850 (3896727) | 3896727..3896993 | - | 267 | WP_010435322.1 | FAD assembly factor SdhE | Antitoxin |
OQE50_RS18855 (3897288) | 3897288..3898268 | + | 981 | WP_014885137.1 | tRNA-modifying protein YgfZ | - |
OQE50_RS18860 (3898353) | 3898353..3899012 | - | 660 | WP_023331242.1 | hemolysin III family protein | - |
OQE50_RS18865 (3899278) | 3899278..3900009 | + | 732 | WP_179121345.1 | MurR/RpiR family transcriptional regulator | - |
OQE50_RS18870 (3900126) | 3900126..3901559 | + | 1434 | WP_014885140.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16135.04 Da Isoelectric Point: 10.7510
>T264422 WP_014885136.1 NZ_CP110873:c3896746-3896336 [Enterobacter kobei]
VVLWQSDLRVSWRSQWMSLMLHGLVAAIVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWDILGMPWMLNSGMMLRLRNVDGGRCQHLWLAADSMDASEWRDLRRMLLQQPTQE
VVLWQSDLRVSWRSQWMSLMLHGLVAAIVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWDILGMPWMLNSGMMLRLRNVDGGRCQHLWLAADSMDASEWRDLRRMLLQQPTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2W0G6Z0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V3PWU7 |