Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
Location | 3877740..3878401 | Replicon | chromosome |
Accession | NZ_CP110873 | ||
Organism | Enterobacter kobei strain SCLZS19 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | - |
Locus tag | OQE50_RS18735 | Protein ID | WP_248188259.1 |
Coordinates | 3877740..3878063 (-) | Length | 108 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | A0A241Q747 |
Locus tag | OQE50_RS18740 | Protein ID | WP_048997880.1 |
Coordinates | 3878084..3878401 (-) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OQE50_RS18715 (3873288) | 3873288..3875039 | - | 1752 | WP_179121184.1 | arsenite efflux transporter ATPase subunit ArsA | - |
OQE50_RS18720 (3875057) | 3875057..3875419 | - | 363 | WP_014885111.1 | arsenite efflux transporter metallochaperone ArsD | - |
OQE50_RS18725 (3875469) | 3875469..3875822 | - | 354 | WP_269195172.1 | As(III)-sensing metalloregulatory transcriptional repressor ArsR | - |
OQE50_RS18730 (3876648) | 3876648..3876968 | + | 321 | WP_228037291.1 | YecR family lipoprotein | - |
OQE50_RS18735 (3877740) | 3877740..3878063 | - | 324 | WP_248188259.1 | TA system toxin CbtA family protein | Toxin |
OQE50_RS18740 (3878084) | 3878084..3878401 | - | 318 | WP_048997880.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
OQE50_RS18745 (3878420) | 3878420..3878641 | - | 222 | WP_048997881.1 | DUF987 domain-containing protein | - |
OQE50_RS18750 (3878650) | 3878650..3879126 | - | 477 | WP_049016517.1 | RadC family protein | - |
OQE50_RS18755 (3879142) | 3879142..3879531 | - | 390 | Protein_3666 | antirestriction protein | - |
OQE50_RS18760 (3879521) | 3879521..3879682 | - | 162 | Protein_3667 | ArsB/NhaD family transporter | - |
OQE50_RS18765 (3879730) | 3879730..3881481 | - | 1752 | WP_248188260.1 | arsenical pump-driving ATPase | - |
OQE50_RS18770 (3881498) | 3881498..3881860 | - | 363 | WP_046449097.1 | arsenite efflux transporter metallochaperone ArsD | - |
OQE50_RS18775 (3881908) | 3881908..3882258 | - | 351 | WP_248188261.1 | transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3876316..3887806 | 11490 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 12412.29 Da Isoelectric Point: 5.6981
>T264421 WP_248188259.1 NZ_CP110873:c3878063-3877740 [Enterobacter kobei]
MKSQPATTQRAAKPCLSPVDVWQMLLTRLLEQHYGLTLNDTPFSEERVIQEHIDAGITLADAINFLVEKYELVRIDRRGF
SWQEQTPYLTIIDIMRARLDLGLLNRN
MKSQPATTQRAAKPCLSPVDVWQMLLTRLLEQHYGLTLNDTPFSEERVIQEHIDAGITLADAINFLVEKYELVRIDRRGF
SWQEQTPYLTIIDIMRARLDLGLLNRN
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|