Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
Location | 980699..981378 | Replicon | chromosome |
Accession | NZ_CP110873 | ||
Organism | Enterobacter kobei strain SCLZS19 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | A0A8B3US07 |
Locus tag | OQE50_RS04690 | Protein ID | WP_007777710.1 |
Coordinates | 980699..981040 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | A0A8B3USS8 |
Locus tag | OQE50_RS04695 | Protein ID | WP_007777712.1 |
Coordinates | 981061..981378 (-) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OQE50_RS04665 (975883) | 975883..976284 | + | 402 | WP_014882682.1 | sigma factor-binding protein Crl | - |
OQE50_RS04670 (976398) | 976398..977450 | - | 1053 | WP_063944063.1 | phosphoporin PhoE | - |
OQE50_RS04675 (977756) | 977756..978859 | + | 1104 | WP_014882684.1 | glutamate 5-kinase | - |
OQE50_RS04680 (978871) | 978871..980124 | + | 1254 | WP_014882685.1 | glutamate-5-semialdehyde dehydrogenase | - |
OQE50_RS04690 (980699) | 980699..981040 | - | 342 | WP_007777710.1 | TA system toxin CbtA family protein | Toxin |
OQE50_RS04695 (981061) | 981061..981378 | - | 318 | WP_007777712.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
OQE50_RS04700 (981445) | 981445..982142 | + | 698 | WP_095033700.1 | IS1-like element IS1B family transposase | - |
OQE50_RS04705 (982158) | 982158..982712 | - | 555 | Protein_911 | hypothetical protein | - |
OQE50_RS04710 (983085) | 983085..983324 | + | 240 | WP_014882702.1 | hypothetical protein | - |
OQE50_RS04715 (983357) | 983357..983736 | + | 380 | Protein_913 | DUF3387 domain-containing protein | - |
OQE50_RS04720 (983803) | 983803..984270 | - | 468 | WP_014882704.1 | GNAT family N-acetyltransferase | - |
OQE50_RS04725 (984567) | 984567..985337 | - | 771 | WP_179120549.1 | class I SAM-dependent methyltransferase | - |
OQE50_RS04730 (985348) | 985348..985605 | - | 258 | WP_014882706.1 | YjhX family toxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12934.88 Da Isoelectric Point: 8.0308
>T264414 WP_007777710.1 NZ_CP110873:c981040-980699 [Enterobacter kobei]
MKTLPATTQRAVKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSEERVIQEHIDAGISLADAVNFLVEKYELVRIDRKGF
NWQEQSPYLQAVDILRARQATGLLQQSRSNVVR
MKTLPATTQRAVKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSEERVIQEHIDAGISLADAVNFLVEKYELVRIDRKGF
NWQEQSPYLQAVDILRARQATGLLQQSRSNVVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A8B3US07 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A8B3USS8 |