Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
| Location | 588025..588728 | Replicon | chromosome |
| Accession | NZ_CP110873 | ||
| Organism | Enterobacter kobei strain SCLZS19 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | - |
| Locus tag | OQE50_RS02860 | Protein ID | WP_040196446.1 |
| Coordinates | 588387..588728 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | - |
| Locus tag | OQE50_RS02855 | Protein ID | WP_044864456.1 |
| Coordinates | 588025..588366 (+) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OQE50_RS02820 (583179) | 583179..584054 | + | 876 | WP_044864450.1 | GTPase family protein | - |
| OQE50_RS02825 (584298) | 584298..585014 | + | 717 | WP_044864451.1 | WYL domain-containing protein | - |
| OQE50_RS02830 (585050) | 585050..585502 | + | 453 | WP_160387433.1 | hypothetical protein | - |
| OQE50_RS02835 (585574) | 585574..586047 | + | 474 | WP_044864453.1 | hypothetical protein | - |
| OQE50_RS02840 (586167) | 586167..586988 | + | 822 | WP_023329299.1 | DUF932 domain-containing protein | - |
| OQE50_RS02845 (587019) | 587019..587459 | + | 441 | WP_023329298.1 | antirestriction protein | - |
| OQE50_RS02850 (587472) | 587472..588014 | + | 543 | WP_044864455.1 | DNA repair protein RadC | - |
| OQE50_RS02855 (588025) | 588025..588366 | + | 342 | WP_044864456.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| OQE50_RS02860 (588387) | 588387..588728 | + | 342 | WP_040196446.1 | TA system toxin CbtA family protein | Toxin |
| OQE50_RS02865 (588987) | 588987..589994 | + | 1008 | WP_044864458.1 | restriction endonuclease | - |
| OQE50_RS02870 (590363) | 590363..591664 | + | 1302 | WP_193970453.1 | tyrosine-type recombinase/integrase | - |
| OQE50_RS02875 (591791) | 591791..592771 | + | 981 | WP_266072557.1 | DNA phosphorothioation-dependent restriction protein DptF | - |
| OQE50_RS02880 (592706) | 592706..593686 | - | 981 | WP_000082736.1 | IS5-like element ISEc68 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | fosA | - | 592706..595416 | 2710 | |
| - | inside | Prophage | fosA | - | 553634..595416 | 41782 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12791.74 Da Isoelectric Point: 7.1648
>T264413 WP_040196446.1 NZ_CP110873:588387-588728 [Enterobacter kobei]
MKTLPATTPQAVTLCLSPVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYELVRIDRRGF
NWQEQSPYLRAVDILRARQATGLLKRNRISAAQ
MKTLPATTPQAVTLCLSPVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYELVRIDRRGF
NWQEQSPYLRAVDILRARQATGLLKRNRISAAQ
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|