Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
| Location | 490090..490685 | Replicon | chromosome |
| Accession | NZ_CP110873 | ||
| Organism | Enterobacter kobei strain SCLZS19 | ||
Toxin (Protein)
| Gene name | chpB | Uniprot ID | - |
| Locus tag | OQE50_RS02380 | Protein ID | WP_032637645.1 |
| Coordinates | 490335..490685 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | chpS | Uniprot ID | - |
| Locus tag | OQE50_RS02375 | Protein ID | WP_047027141.1 |
| Coordinates | 490090..490341 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OQE50_RS02365 (485757) | 485757..489533 | + | 3777 | WP_179120454.1 | autotransporter assembly complex protein TamB | - |
| OQE50_RS02370 (489536) | 489536..489880 | + | 345 | WP_014882267.1 | gamma-glutamylcyclotransferase | - |
| OQE50_RS02375 (490090) | 490090..490341 | + | 252 | WP_047027141.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| OQE50_RS02380 (490335) | 490335..490685 | + | 351 | WP_032637645.1 | type II toxin-antitoxin system ChpB family toxin | Toxin |
| OQE50_RS02385 (490763) | 490763..491293 | - | 531 | WP_008501423.1 | inorganic diphosphatase | - |
| OQE50_RS02390 (491603) | 491603..492559 | + | 957 | WP_047626912.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
| OQE50_RS02395 (492662) | 492662..494164 | + | 1503 | WP_045134407.1 | sugar ABC transporter ATP-binding protein | - |
| OQE50_RS02400 (494175) | 494175..495200 | + | 1026 | WP_014882273.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12354.33 Da Isoelectric Point: 6.9493
>T264412 WP_032637645.1 NZ_CP110873:490335-490685 [Enterobacter kobei]
MVKRPCFERGDIVLVGFDPANGHEQKGAGRPALVLSVSAFNQLGMTLVAPVTQGGNFARYAGFSVPLSCEEGNIQGVILV
NQIRMMDLGARLAKRIGVASDETVEDALLRLQAILS
MVKRPCFERGDIVLVGFDPANGHEQKGAGRPALVLSVSAFNQLGMTLVAPVTQGGNFARYAGFSVPLSCEEGNIQGVILV
NQIRMMDLGARLAKRIGVASDETVEDALLRLQAILS
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|