264410

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/MqsA(antitoxin)
Location 52112..52577 Replicon plasmid p56
Accession NZ_CP110861
Organism Escherichia coli strain TSW4881-W1

Toxin (Protein)


Gene name TsxA Uniprot ID M7C8T2
Locus tag OQ464_RS22640 Protein ID WP_001230706.1
Coordinates 52329..52577 (-) Length 83 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID M7CCF8
Locus tag OQ464_RS22635 Protein ID WP_000801440.1
Coordinates 52112..52339 (-) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OQ464_RS22595 (OQ464_22595) 47254..47547 - 294 WP_000134733.1 sigma factor-like helix-turn-helix DNA-binding protein -
OQ464_RS22600 (OQ464_22600) 47624..48853 - 1230 WP_016231858.1 DNA relaxase/nickase TaxC -
OQ464_RS22605 (OQ464_22605) 48857..49360 - 504 WP_000781814.1 relaxosome-coupling protein TaxA -
OQ464_RS22610 (OQ464_22610) 49723..50070 - 348 WP_000681613.1 type II toxin-antitoxin system HicB family antitoxin -
OQ464_RS22615 (OQ464_22615) 50067..50315 - 249 WP_000520549.1 type II toxin-antitoxin system HicA family toxin -
OQ464_RS22620 (OQ464_22620) 50625..50918 - 294 WP_001401669.1 hypothetical protein -
OQ464_RS22625 (OQ464_22625) 50933..51307 - 375 WP_000844303.1 tail-associated lysozyme -
OQ464_RS22630 (OQ464_22630) 51359..51658 - 300 WP_263955274.1 hypothetical protein -
OQ464_RS22635 (OQ464_22635) 52112..52339 - 228 WP_000801440.1 hypothetical protein Antitoxin
OQ464_RS22640 (OQ464_22640) 52329..52577 - 249 WP_001230706.1 hypothetical protein Toxin
OQ464_RS22645 (OQ464_22645) 52574..53116 - 543 WP_001083906.1 hypothetical protein -
OQ464_RS22650 (OQ464_22650) 53221..53736 - 516 WP_001025395.1 J domain-containing protein -
OQ464_RS22655 (OQ464_22655) 54376..54726 - 351 WP_000127482.1 addiction module antitoxin -
OQ464_RS22660 (OQ464_22660) 54723..55058 - 336 WP_001147119.1 type II toxin-antitoxin system RelE/ParE family toxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aph(6)-Id / aph(3'')-Ib / sul2 / dfrA5 / tet(A) - 1..56157 56157


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 83 a.a.        Molecular weight: 9594.94 Da        Isoelectric Point: 7.9925

>T264410 WP_001230706.1 NZ_CP110861:c52577-52329 [Escherichia coli]
MRKNKGDVTYFLEKEGDNYRLTKRIKARTNVKIGNKTTKITLYDAVLNENELQHIDFTCAGLREDDETPVKNLIKEFMLN
ET

Download         Length: 249 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8659.98 Da        Isoelectric Point: 8.5105

>AT264410 WP_000801440.1 NZ_CP110861:c52339-52112 [Escherichia coli]
MKPDNTPENVKKLRLKAGLTQKECSHIYGVGLRTWQKKEEVNTQNSQSLSLVEFEFLLLLAGEHPEYVLCKRESK

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB M7C8T2

Antitoxin

Source ID Structure
AlphaFold DB A0A5Y6U8W9

References