Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/-
Location 49723..50315 Replicon plasmid p56
Accession NZ_CP110861
Organism Escherichia coli strain TSW4881-W1

Toxin (Protein)


Gene name hicA Uniprot ID V0AGQ2
Locus tag OQ464_RS22615 Protein ID WP_000520549.1
Coordinates 50067..50315 (-) Length 83 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID V0AWG0
Locus tag OQ464_RS22610 Protein ID WP_000681613.1
Coordinates 49723..50070 (-) Length 116 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OQ464_RS22580 (OQ464_22580) 45725..46051 - 327 WP_000008644.1 TrbC/VirB2 family protein -
OQ464_RS22585 (OQ464_22585) 46065..46685 - 621 WP_000157549.1 lytic transglycosylase domain-containing protein -
OQ464_RS22590 (OQ464_22590) 47042..47257 - 216 WP_000760375.1 EexN family lipoprotein -
OQ464_RS22595 (OQ464_22595) 47254..47547 - 294 WP_000134733.1 sigma factor-like helix-turn-helix DNA-binding protein -
OQ464_RS22600 (OQ464_22600) 47624..48853 - 1230 WP_016231858.1 DNA relaxase/nickase TaxC -
OQ464_RS22605 (OQ464_22605) 48857..49360 - 504 WP_000781814.1 relaxosome-coupling protein TaxA -
OQ464_RS22610 (OQ464_22610) 49723..50070 - 348 WP_000681613.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
OQ464_RS22615 (OQ464_22615) 50067..50315 - 249 WP_000520549.1 type II toxin-antitoxin system HicA family toxin Toxin
OQ464_RS22620 (OQ464_22620) 50625..50918 - 294 WP_001401669.1 hypothetical protein -
OQ464_RS22625 (OQ464_22625) 50933..51307 - 375 WP_000844303.1 tail-associated lysozyme -
OQ464_RS22630 (OQ464_22630) 51359..51658 - 300 WP_263955274.1 hypothetical protein -
OQ464_RS22635 (OQ464_22635) 52112..52339 - 228 WP_000801440.1 hypothetical protein -
OQ464_RS22640 (OQ464_22640) 52329..52577 - 249 WP_001230706.1 hypothetical protein -
OQ464_RS22645 (OQ464_22645) 52574..53116 - 543 WP_001083906.1 hypothetical protein -
OQ464_RS22650 (OQ464_22650) 53221..53736 - 516 WP_001025395.1 J domain-containing protein -
OQ464_RS22655 (OQ464_22655) 54376..54726 - 351 WP_000127482.1 addiction module antitoxin -
OQ464_RS22660 (OQ464_22660) 54723..55058 - 336 WP_001147119.1 type II toxin-antitoxin system RelE/ParE family toxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aph(6)-Id / aph(3'')-Ib / sul2 / dfrA5 / tet(A) - 1..56157 56157


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(20-81)

Antitoxin

Uncharacterised protein family HicB

(54-104)


Sequences

Toxin        


Download         Length: 83 a.a.        Molecular weight: 9422.08 Da        Isoelectric Point: 10.4800

>T264409 WP_000520549.1 NZ_CP110861:c50315-50067 [Escherichia coli]
MGKTDKLLAKFLNSKKTFEWDELVVLFSSLGYVKKEMQGSRVRFFNAEINHTILMHRPHPESYIKGGTLKAIKQNLKEAG
LL

Download         Length: 249 bp

Antitoxin


Download         Length: 116 a.a.        Molecular weight: 13113.84 Da        Isoelectric Point: 4.6723

>AT264409 WP_000681613.1 NZ_CP110861:c50070-49723 [Escherichia coli]
MKHLKYKGYLGTVEPDFENNVLYGKLAFIRDLVTYEASTLAELEQEFKTSVDLYLQSCVEDGKEPDTPFKGVFNVRLDPE
LHRRVAEMAMEEDLSLNAFVNKALEKEVSNHRAGA

Download         Length: 348 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CIX3

Antitoxin

Source ID Structure
AlphaFold DB A0A829CLC1

References