Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 3891307..3891902 | Replicon | chromosome |
Accession | NZ_CP110859 | ||
Organism | Escherichia coli strain TSW4881-W1 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | U9XNP6 |
Locus tag | OQ464_RS19105 | Protein ID | WP_000239577.1 |
Coordinates | 3891307..3891657 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | U9Y2K1 |
Locus tag | OQ464_RS19110 | Protein ID | WP_001223208.1 |
Coordinates | 3891651..3891902 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OQ464_RS19085 (3887644) | 3887644..3887775 | - | 132 | Protein_3726 | ABC transporter permease | - |
OQ464_RS19090 (3887789) | 3887789..3889291 | - | 1503 | WP_000205805.1 | sugar ABC transporter ATP-binding protein | - |
OQ464_RS19095 (3889431) | 3889431..3890387 | - | 957 | WP_000265913.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
OQ464_RS19100 (3890697) | 3890697..3891227 | + | 531 | WP_000055075.1 | inorganic diphosphatase | - |
OQ464_RS19105 (3891307) | 3891307..3891657 | - | 351 | WP_000239577.1 | endoribonuclease toxin ChpB | Toxin |
OQ464_RS19110 (3891651) | 3891651..3891902 | - | 252 | WP_001223208.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
OQ464_RS19115 (3892114) | 3892114..3892455 | - | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
OQ464_RS19120 (3892458) | 3892458..3896237 | - | 3780 | WP_000060911.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12492.40 Da Isoelectric Point: 5.5572
>T264407 WP_000239577.1 NZ_CP110859:c3891657-3891307 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLHARLAKRIGLAADEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLHARLAKRIGLAADEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | U9XNP6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LQ26 |