Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yafW-ykfI/CbtA-CbeA |
| Location | 3515262..3515941 | Replicon | chromosome |
| Accession | NZ_CP110859 | ||
| Organism | Escherichia coli strain TSW4881-W1 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | P77692 |
| Locus tag | OQ464_RS17255 | Protein ID | WP_000854672.1 |
| Coordinates | 3515600..3515941 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yafW | Uniprot ID | Q47684 |
| Locus tag | OQ464_RS17250 | Protein ID | WP_000070395.1 |
| Coordinates | 3515262..3515579 (+) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OQ464_RS17200 (3510309) | 3510309..3511172 | + | 864 | WP_001065553.1 | GTPase family protein | - |
| OQ464_RS17205 (3511264) | 3511264..3512085 | + | 822 | WP_000197389.1 | DUF932 domain-containing protein | - |
| OQ464_RS17210 (3512302) | 3512302..3512493 | + | 192 | Protein_3363 | DeoR family transcriptional regulator | - |
| OQ464_RS17215 (3512540) | 3512540..3512716 | + | 177 | WP_001285112.1 | hypothetical protein | - |
| OQ464_RS17220 (3512716) | 3512716..3513159 | + | 444 | WP_000824223.1 | lipoprotein YafY | - |
| OQ464_RS17225 (3513182) | 3513182..3513649 | + | 468 | WP_001547765.1 | protein YkfB | - |
| OQ464_RS17230 (3513726) | 3513726..3513965 | + | 240 | WP_000194654.1 | DUF905 family protein | - |
| OQ464_RS17235 (3514063) | 3514063..3514521 | + | 459 | WP_000211838.1 | antirestriction protein | - |
| OQ464_RS17240 (3514537) | 3514537..3515013 | + | 477 | WP_000811693.1 | RadC family protein | - |
| OQ464_RS17245 (3515022) | 3515022..3515243 | + | 222 | WP_000691994.1 | DUF987 domain-containing protein | - |
| OQ464_RS17250 (3515262) | 3515262..3515579 | + | 318 | WP_000070395.1 | type IV toxin-antitoxin system antitoxin YafW | Antitoxin |
| OQ464_RS17255 (3515600) | 3515600..3515941 | + | 342 | WP_000854672.1 | type IV toxin-antitoxin system toxin YkfI | Toxin |
| OQ464_RS17265 (3516513) | 3516513..3517766 | - | 1254 | WP_000893278.1 | glutamate-5-semialdehyde dehydrogenase | - |
| OQ464_RS17270 (3517778) | 3517778..3518881 | - | 1104 | WP_001285288.1 | glutamate 5-kinase | - |
| OQ464_RS17275 (3519169) | 3519169..3520224 | + | 1056 | WP_000749863.1 | phosphoporin PhoE | - |
| OQ464_RS17280 (3520263) | 3520263..3520664 | - | 402 | WP_000174689.1 | sigma factor-binding protein Crl | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12905.01 Da Isoelectric Point: 9.6543
>T264403 WP_000854672.1 NZ_CP110859:3515600-3515941 [Escherichia coli]
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|