Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yafW-ykfI/CbtA-CbeA
Location 3515262..3515941 Replicon chromosome
Accession NZ_CP110859
Organism Escherichia coli strain TSW4881-W1

Toxin (Protein)


Gene name ykfI Uniprot ID P77692
Locus tag OQ464_RS17255 Protein ID WP_000854672.1
Coordinates 3515600..3515941 (+) Length 114 a.a.

Antitoxin (Protein)


Gene name yafW Uniprot ID Q47684
Locus tag OQ464_RS17250 Protein ID WP_000070395.1
Coordinates 3515262..3515579 (+) Length 106 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OQ464_RS17200 (3510309) 3510309..3511172 + 864 WP_001065553.1 GTPase family protein -
OQ464_RS17205 (3511264) 3511264..3512085 + 822 WP_000197389.1 DUF932 domain-containing protein -
OQ464_RS17210 (3512302) 3512302..3512493 + 192 Protein_3363 DeoR family transcriptional regulator -
OQ464_RS17215 (3512540) 3512540..3512716 + 177 WP_001285112.1 hypothetical protein -
OQ464_RS17220 (3512716) 3512716..3513159 + 444 WP_000824223.1 lipoprotein YafY -
OQ464_RS17225 (3513182) 3513182..3513649 + 468 WP_001547765.1 protein YkfB -
OQ464_RS17230 (3513726) 3513726..3513965 + 240 WP_000194654.1 DUF905 family protein -
OQ464_RS17235 (3514063) 3514063..3514521 + 459 WP_000211838.1 antirestriction protein -
OQ464_RS17240 (3514537) 3514537..3515013 + 477 WP_000811693.1 RadC family protein -
OQ464_RS17245 (3515022) 3515022..3515243 + 222 WP_000691994.1 DUF987 domain-containing protein -
OQ464_RS17250 (3515262) 3515262..3515579 + 318 WP_000070395.1 type IV toxin-antitoxin system antitoxin YafW Antitoxin
OQ464_RS17255 (3515600) 3515600..3515941 + 342 WP_000854672.1 type IV toxin-antitoxin system toxin YkfI Toxin
OQ464_RS17265 (3516513) 3516513..3517766 - 1254 WP_000893278.1 glutamate-5-semialdehyde dehydrogenase -
OQ464_RS17270 (3517778) 3517778..3518881 - 1104 WP_001285288.1 glutamate 5-kinase -
OQ464_RS17275 (3519169) 3519169..3520224 + 1056 WP_000749863.1 phosphoporin PhoE -
OQ464_RS17280 (3520263) 3520263..3520664 - 402 WP_000174689.1 sigma factor-binding protein Crl -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(6-104)


Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 12905.01 Da        Isoelectric Point: 9.6543

>T264403 WP_000854672.1 NZ_CP110859:3515600-3515941 [Escherichia coli]
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR

Download         Length: 342 bp

Antitoxin


Download         Length: 106 a.a.        Molecular weight: 11939.59 Da        Isoelectric Point: 6.7391

>AT264403 WP_000070395.1 NZ_CP110859:3515262-3515579 [Escherichia coli]
MSNPTRGLQREITLRLGARLVQEGNRLHYLADRASITGKFSDIECRKLDETFPHFILQMESMLTTGELSPHHAHCVTLYH
NDLTCEADTLGSCGYVYIAIYPTQR

Download         Length: 318 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB P77692

Antitoxin

Source ID Structure
AlphaFold DB Q47684

References