Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3333334..3333952 | Replicon | chromosome |
| Accession | NZ_CP110859 | ||
| Organism | Escherichia coli strain TSW4881-W1 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | - |
| Locus tag | OQ464_RS16290 | Protein ID | WP_001290581.1 |
| Coordinates | 3333734..3333952 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | OQ464_RS16285 | Protein ID | WP_000344800.1 |
| Coordinates | 3333334..3333708 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OQ464_RS16275 (3328423) | 3328423..3329616 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| OQ464_RS16280 (3329639) | 3329639..3332788 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
| OQ464_RS16285 (3333334) | 3333334..3333708 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| OQ464_RS16290 (3333734) | 3333734..3333952 | + | 219 | WP_001290581.1 | HHA domain-containing protein | Toxin |
| OQ464_RS16295 (3334124) | 3334124..3334675 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
| OQ464_RS16300 (3334791) | 3334791..3335261 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| OQ464_RS16305 (3335425) | 3335425..3336975 | + | 1551 | WP_001310610.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| OQ464_RS16310 (3337017) | 3337017..3337370 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| OQ464_RS16320 (3337749) | 3337749..3338060 | + | 312 | WP_000409911.1 | MGMT family protein | - |
| OQ464_RS16325 (3338091) | 3338091..3338663 | - | 573 | WP_000779842.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8678.06 Da Isoelectric Point: 8.9008
>T264402 WP_001290581.1 NZ_CP110859:3333734-3333952 [Escherichia coli]
MSEKFLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKFLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT264402 WP_000344800.1 NZ_CP110859:3333334-3333708 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|