Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2380574..2381212 | Replicon | chromosome |
Accession | NZ_CP110859 | ||
Organism | Escherichia coli strain TSW4881-W1 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | OQ464_RS11555 | Protein ID | WP_000813794.1 |
Coordinates | 2381036..2381212 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | OQ464_RS11550 | Protein ID | WP_001270286.1 |
Coordinates | 2380574..2380990 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OQ464_RS11530 (2375726) | 2375726..2376667 | - | 942 | WP_001251304.1 | ABC transporter permease | - |
OQ464_RS11535 (2376668) | 2376668..2377681 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
OQ464_RS11540 (2377699) | 2377699..2378844 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
OQ464_RS11545 (2379089) | 2379089..2380495 | - | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
OQ464_RS11550 (2380574) | 2380574..2380990 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
OQ464_RS11555 (2381036) | 2381036..2381212 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
OQ464_RS11560 (2381434) | 2381434..2381664 | + | 231 | WP_000494244.1 | YncJ family protein | - |
OQ464_RS11565 (2381756) | 2381756..2383717 | - | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
OQ464_RS11570 (2383790) | 2383790..2384326 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
OQ464_RS11575 (2384418) | 2384418..2385593 | + | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T264401 WP_000813794.1 NZ_CP110859:c2381212-2381036 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT264401 WP_001270286.1 NZ_CP110859:c2380990-2380574 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|