Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1812142..1812973 | Replicon | chromosome |
| Accession | NZ_CP110859 | ||
| Organism | Escherichia coli strain TSW4881-W1 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1P968 |
| Locus tag | OQ464_RS08650 | Protein ID | WP_000854814.1 |
| Coordinates | 1812142..1812516 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | P76364 |
| Locus tag | OQ464_RS08655 | Protein ID | WP_001285584.1 |
| Coordinates | 1812605..1812973 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OQ464_RS08610 (1807538) | 1807538..1808704 | + | 1167 | WP_000830156.1 | serine-type D-Ala-D-Ala carboxypeptidase DacD | - |
| OQ464_RS08615 (1808823) | 1808823..1809296 | + | 474 | WP_001105415.1 | DNA gyrase inhibitor SbmC | - |
| OQ464_RS08620 (1809494) | 1809494..1810552 | + | 1059 | WP_001200891.1 | FUSC family protein | - |
| OQ464_RS08625 (1810724) | 1810724..1811053 | + | 330 | WP_000450409.1 | DUF496 family protein | - |
| OQ464_RS08630 (1811154) | 1811154..1811288 | - | 135 | WP_001297944.1 | EutP/PduV family microcompartment system protein | - |
| OQ464_RS08635 (1811408) | 1811408..1811536 | + | 129 | Protein_1689 | transposase domain-containing protein | - |
| OQ464_RS08640 (1811825) | 1811825..1811905 | - | 81 | Protein_1690 | hypothetical protein | - |
| OQ464_RS08645 (1811951) | 1811951..1812145 | - | 195 | WP_000988600.1 | DUF5983 family protein | - |
| OQ464_RS08650 (1812142) | 1812142..1812516 | - | 375 | WP_000854814.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| OQ464_RS08655 (1812605) | 1812605..1812973 | - | 369 | WP_001285584.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| OQ464_RS08660 (1813047) | 1813047..1813268 | - | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
| OQ464_RS08665 (1813331) | 1813331..1813777 | - | 447 | WP_000187523.1 | RadC family protein | - |
| OQ464_RS08670 (1813774) | 1813774..1815306 | - | 1533 | WP_001350525.1 | protein YeeR | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13898.94 Da Isoelectric Point: 7.8522
>T264394 WP_000854814.1 NZ_CP110859:c1812516-1812142 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13651.52 Da Isoelectric Point: 5.9541
>AT264394 WP_001285584.1 NZ_CP110859:c1812973-1812605 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829FY50 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2H28 | |
| AlphaFold DB | A0A1M2E8G6 |