Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
| Location | 4779605..4780221 | Replicon | chromosome |
| Accession | NZ_CP110857 | ||
| Organism | Enterobacter hormaechei strain K432 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | OQO37_RS23255 | Protein ID | WP_015569913.1 |
| Coordinates | 4779605..4779976 (-) | Length | 124 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A6G4MTK3 |
| Locus tag | OQO37_RS23260 | Protein ID | WP_015569912.1 |
| Coordinates | 4779979..4780221 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OQO37_RS23240 (OQO37_23240) | 4777105..4778007 | + | 903 | WP_014072386.1 | formate dehydrogenase subunit beta | - |
| OQO37_RS23245 (OQO37_23245) | 4778004..4778639 | + | 636 | WP_015569914.1 | formate dehydrogenase cytochrome b556 subunit | - |
| OQO37_RS23250 (OQO37_23250) | 4778636..4779565 | + | 930 | WP_003861956.1 | formate dehydrogenase accessory protein FdhE | - |
| OQO37_RS23255 (OQO37_23255) | 4779605..4779976 | - | 372 | WP_015569913.1 | PIN domain-containing protein | Toxin |
| OQO37_RS23260 (OQO37_23260) | 4779979..4780221 | - | 243 | WP_015569912.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| OQO37_RS23265 (OQO37_23265) | 4780420..4781340 | + | 921 | WP_015569911.1 | alpha/beta hydrolase | - |
| OQO37_RS23270 (OQO37_23270) | 4781349..4782290 | - | 942 | WP_015569910.1 | fatty acid biosynthesis protein FabY | - |
| OQO37_RS23275 (OQO37_23275) | 4782335..4782772 | - | 438 | WP_015569909.1 | D-aminoacyl-tRNA deacylase | - |
| OQO37_RS23280 (OQO37_23280) | 4782769..4783650 | - | 882 | WP_003861949.1 | virulence factor BrkB family protein | - |
| OQO37_RS23285 (OQO37_23285) | 4783644..4784243 | - | 600 | WP_003861947.1 | glucose-1-phosphatase | - |
| OQO37_RS23290 (OQO37_23290) | 4784362..4785162 | - | 801 | WP_003861944.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13767.90 Da Isoelectric Point: 6.4882
>T264385 WP_015569913.1 NZ_CP110857:c4779976-4779605 [Enterobacter hormaechei]
MEHMAVFDTNILIDLFNNRIEAADAIEHTASHRAISLITWMEVMVSARRHGHEAKTAAVMGAFEIIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVLTPYQV
MEHMAVFDTNILIDLFNNRIEAADAIEHTASHRAISLITWMEVMVSARRHGHEAKTAAVMGAFEIIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVLTPYQV
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|