Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3904589..3905246 | Replicon | chromosome |
| Accession | NZ_CP110857 | ||
| Organism | Enterobacter hormaechei strain K432 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A179PSF7 |
| Locus tag | OQO37_RS19075 | Protein ID | WP_017382887.1 |
| Coordinates | 3904589..3904999 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | G8LDB7 |
| Locus tag | OQO37_RS19080 | Protein ID | WP_003863437.1 |
| Coordinates | 3904980..3905246 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OQO37_RS19055 (OQO37_19055) | 3900587..3902320 | - | 1734 | WP_023304383.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| OQO37_RS19060 (OQO37_19060) | 3902326..3903039 | - | 714 | WP_023295380.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| OQO37_RS19065 (OQO37_19065) | 3903068..3903964 | - | 897 | WP_023304385.1 | site-specific tyrosine recombinase XerD | - |
| OQO37_RS19070 (OQO37_19070) | 3904066..3904587 | + | 522 | WP_015571793.1 | flavodoxin FldB | - |
| OQO37_RS19075 (OQO37_19075) | 3904589..3904999 | - | 411 | WP_017382887.1 | protein YgfX | Toxin |
| OQO37_RS19080 (OQO37_19080) | 3904980..3905246 | - | 267 | WP_003863437.1 | FAD assembly factor SdhE | Antitoxin |
| OQO37_RS19085 (OQO37_19085) | 3905541..3906521 | + | 981 | WP_022649306.1 | tRNA-modifying protein YgfZ | - |
| OQO37_RS19090 (OQO37_19090) | 3906633..3907292 | - | 660 | WP_003863433.1 | hemolysin III family protein | - |
| OQO37_RS19095 (OQO37_19095) | 3907559..3908290 | + | 732 | WP_015571796.1 | MurR/RpiR family transcriptional regulator | - |
| OQO37_RS19100 (OQO37_19100) | 3908407..3909840 | + | 1434 | WP_017382891.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16321.21 Da Isoelectric Point: 11.4775
>T264384 WP_017382887.1 NZ_CP110857:c3904999-3904589 [Enterobacter hormaechei]
VVLWQSDLRVSWRSQWMSLLLHGLVAALVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMMGTPWMLNTGMMLRLRRVEDNRRQHLWLAADSMDPAEWRDLRRLIVQQPTQE
VVLWQSDLRVSWRSQWMSLLLHGLVAALVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMMGTPWMLNTGMMLRLRRVEDNRRQHLWLAADSMDPAEWRDLRRLIVQQPTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A179PSF7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837F8P5 |