Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 2858622..2859227 Replicon chromosome
Accession NZ_CP110857
Organism Enterobacter hormaechei strain K432

Toxin (Protein)


Gene name hicA Uniprot ID D2TUP9
Locus tag OQO37_RS13765 Protein ID WP_012906750.1
Coordinates 2858622..2858801 (+) Length 60 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A822X3T2
Locus tag OQO37_RS13770 Protein ID WP_032619507.1
Coordinates 2858823..2859227 (+) Length 135 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OQO37_RS13735 (OQO37_13735) 2853951..2854667 + 717 WP_032619512.1 ABC transporter ATP-binding protein -
OQO37_RS13740 (OQO37_13740) 2854833..2855303 + 471 WP_017384432.1 hypothetical protein -
OQO37_RS13745 (OQO37_13745) 2855309..2856235 - 927 WP_032619511.1 LysR substrate-binding domain-containing protein -
OQO37_RS13750 (OQO37_13750) 2856265..2856588 - 324 WP_017384434.1 hypothetical protein -
OQO37_RS13755 (OQO37_13755) 2856591..2856938 - 348 WP_230199855.1 DUF4225 domain-containing protein -
OQO37_RS13760 (OQO37_13760) 2857005..2857346 - 342 WP_223862348.1 DUF4225 domain-containing protein -
OQO37_RS13765 (OQO37_13765) 2858622..2858801 + 180 WP_012906750.1 type II toxin-antitoxin system HicA family toxin Toxin
OQO37_RS13770 (OQO37_13770) 2858823..2859227 + 405 WP_032619507.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
OQO37_RS13775 (OQO37_13775) 2859268..2860338 - 1071 WP_032635096.1 glycosyltransferase family 9 protein -
OQO37_RS13780 (OQO37_13780) 2860415..2860993 - 579 WP_032619505.1 tail fiber assembly protein -
OQO37_RS13785 (OQO37_13785) 2860993..2863170 - 2178 WP_058670599.1 phage tail protein -
OQO37_RS13790 (OQO37_13790) 2863173..2863724 - 552 WP_032619504.1 phage tail protein I -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - fliA 2853963..2964863 110900


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(4-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-126)


Sequences

Toxin        


Download         Length: 60 a.a.        Molecular weight: 6644.85 Da        Isoelectric Point: 10.9132

>T264382 WP_012906750.1 NZ_CP110857:2858622-2858801 [Enterobacter hormaechei]
MDSRNAIAMIEADGWYLVRVKGSHHQFKHPTKKGLVTVKHPQKDIPLPTLKSIKKQAGL

Download         Length: 180 bp

Antitoxin


Download         Length: 135 a.a.        Molecular weight: 14676.53 Da        Isoelectric Point: 4.2136

>AT264382 WP_032619507.1 NZ_CP110857:2858823-2859227 [Enterobacter hormaechei]
MLYPVAIDKGDSSFGVRVPDIPGCFSGGEDYQDAIESVREAIEAHIELLVEDGESVPEATTVENWLSDPEYAGAVWALVD
VDITRLMGKAEKINVTLPSLLIRRIDQFVAAHPEYGSRSGFLSRVAADKVINQR

Download         Length: 405 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7D6XDK4

Antitoxin

Source ID Structure
AlphaFold DB A0A822X3T2

References