Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 2383315..2384054 | Replicon | chromosome |
| Accession | NZ_CP110857 | ||
| Organism | Enterobacter hormaechei strain K432 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A822W909 |
| Locus tag | OQO37_RS11520 | Protein ID | WP_017382345.1 |
| Coordinates | 2383315..2383800 (-) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | A0A837FCR9 |
| Locus tag | OQO37_RS11525 | Protein ID | WP_003857131.1 |
| Coordinates | 2383788..2384054 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OQO37_RS11500 (OQO37_11500) | 2379545..2379832 | + | 288 | WP_003033743.1 | DUF2523 family protein | - |
| OQO37_RS11505 (OQO37_11505) | 2379836..2380870 | + | 1035 | WP_234101229.1 | zonular occludens toxin domain-containing protein | - |
| OQO37_RS11510 (OQO37_11510) | 2380867..2382129 | + | 1263 | WP_234101230.1 | type II secretion system protein GspD | - |
| OQO37_RS11515 (OQO37_11515) | 2382695..2383264 | + | 570 | WP_017382346.1 | hypothetical protein | - |
| OQO37_RS11520 (OQO37_11520) | 2383315..2383800 | - | 486 | WP_017382345.1 | GNAT family N-acetyltransferase | Toxin |
| OQO37_RS11525 (OQO37_11525) | 2383788..2384054 | - | 267 | WP_003857131.1 | DUF1778 domain-containing protein | Antitoxin |
| OQO37_RS11530 (OQO37_11530) | 2384118..2385047 | - | 930 | WP_023303744.1 | LysR family transcriptional regulator | - |
| OQO37_RS11535 (OQO37_11535) | 2385177..2386565 | + | 1389 | WP_032619651.1 | MFS transporter | - |
| OQO37_RS11540 (OQO37_11540) | 2386587..2387582 | - | 996 | WP_023303746.1 | DUF2891 domain-containing protein | - |
| OQO37_RS11545 (OQO37_11545) | 2387592..2388578 | - | 987 | WP_017382341.1 | DUF979 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2347961..2384054 | 36093 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17510.21 Da Isoelectric Point: 9.9658
>T264377 WP_017382345.1 NZ_CP110857:c2383800-2383315 [Enterobacter hormaechei]
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARAFVVCKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIILARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKAFYIHHGFKASQTQERTLFLRLP
Q
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARAFVVCKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIILARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKAFYIHHGFKASQTQERTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A822W909 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837FCR9 |