Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF-MazE |
Location | 3184965..3185548 | Replicon | chromosome |
Accession | NZ_CP110848 | ||
Organism | Trichothermofontia sichuanensis PKUAC-SCTB231 |
Toxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | OOK60_RS13560 | Protein ID | WP_265901038.1 |
Coordinates | 3184965..3185294 (-) | Length | 110 a.a. |
Antitoxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | OOK60_RS13565 | Protein ID | WP_265901039.1 |
Coordinates | 3185282..3185548 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OOK60_RS13550 (OOK60_13550) | 3180450..3180738 | + | 289 | Protein_2666 | transposase | - |
OOK60_RS13555 (OOK60_13555) | 3180881..3184924 | + | 4044 | WP_265901037.1 | hypothetical protein | - |
OOK60_RS13560 (OOK60_13560) | 3184965..3185294 | - | 330 | WP_265901038.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
OOK60_RS13565 (OOK60_13565) | 3185282..3185548 | - | 267 | WP_265901039.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
OOK60_RS13570 (OOK60_13570) | 3186191..3187780 | - | 1590 | WP_265901040.1 | calcium-binding protein | - |
OOK60_RS13575 (OOK60_13575) | 3188337..3189434 | - | 1098 | WP_265904197.1 | calcium-binding protein | - |
OOK60_RS13580 (OOK60_13580) | 3189609..3189971 | + | 363 | WP_265901041.1 | hypothetical protein | - |
OOK60_RS13585 (OOK60_13585) | 3190187..3190336 | - | 150 | WP_265901042.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12423.47 Da Isoelectric Point: 5.1828
>T264373 WP_265901038.1 NZ_CP110848:c3185294-3184965 [Trichothermofontia sichuanensis PKUAC-SCTB231]
MGLVVQRFDVFLVNLDPTVGREIQKARPCVVISPDEMNRYIDTVIIAPMTTEGKAYPTRVICQFQGKDGQIVLDQIRTID
KRRLVKKLGQISQDEQKEVLDTLAEMFAE
MGLVVQRFDVFLVNLDPTVGREIQKARPCVVISPDEMNRYIDTVIIAPMTTEGKAYPTRVICQFQGKDGQIVLDQIRTID
KRRLVKKLGQISQDEQKEVLDTLAEMFAE
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|