Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN-PHD |
Location | 1951543..1952180 | Replicon | chromosome |
Accession | NZ_CP110848 | ||
Organism | Trichothermofontia sichuanensis PKUAC-SCTB231 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | OOK60_RS08310 | Protein ID | WP_265903879.1 |
Coordinates | 1951543..1951938 (-) | Length | 132 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | OOK60_RS08315 | Protein ID | WP_265903880.1 |
Coordinates | 1951935..1952180 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OOK60_RS08300 (OOK60_08300) | 1947272..1949863 | + | 2592 | WP_265903877.1 | leucine--tRNA ligase | - |
OOK60_RS08305 (OOK60_08305) | 1950848..1951345 | + | 498 | WP_265903878.1 | hypothetical protein | - |
OOK60_RS08310 (OOK60_08310) | 1951543..1951938 | - | 396 | WP_265903879.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OOK60_RS08315 (OOK60_08315) | 1951935..1952180 | - | 246 | WP_265903880.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
OOK60_RS08320 (OOK60_08320) | 1952231..1952656 | - | 426 | WP_265904150.1 | MAPEG family protein | - |
OOK60_RS08325 (OOK60_08325) | 1952672..1953925 | - | 1254 | WP_265904151.1 | tryptophan synthase subunit beta | - |
OOK60_RS08330 (OOK60_08330) | 1954115..1954351 | + | 237 | WP_265903881.1 | hypothetical protein | - |
OOK60_RS08335 (OOK60_08335) | 1954666..1955232 | - | 567 | WP_265903882.1 | hypothetical protein | - |
OOK60_RS08340 (OOK60_08340) | 1955706..1956485 | - | 780 | WP_265903883.1 | iron export ABC transporter permease subunit FetB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 14996.11 Da Isoelectric Point: 4.2386
>T264372 WP_265903879.1 NZ_CP110848:c1951938-1951543 [Trichothermofontia sichuanensis PKUAC-SCTB231]
VKLLLDTQCWLWWFAQPEKLNENVIEQIADETNEVWFSVMSIWEMGIKVSIGKLSLPEQIDDYISSRMTQLGARSLEITA
SHALRVAALLHHRDPFDQMLIAQAQVEEMTLVSADSTFNQYEVSLLWAANS
VKLLLDTQCWLWWFAQPEKLNENVIEQIADETNEVWFSVMSIWEMGIKVSIGKLSLPEQIDDYISSRMTQLGARSLEITA
SHALRVAALLHHRDPFDQMLIAQAQVEEMTLVSADSTFNQYEVSLLWAANS
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|